(data stored in ACNUC29543 zone)

EMBL: CP000521.PE254

CP000521.PE254       Location/Qualifiers
FT   CDS_pept        286993..287733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0261"
FT                   /product="alginate biosynthesis regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10736"
FT                   /protein_id="ABO10736.2"
FT                   /translation="MKVLICDDEPLAVERLSRLVSKMGHEVVATAHHGQDALEQARLHH
FT                   PDVILLDIQMPGMNGLVCAEQLSQLNPRPAIVFCTAYDQHALEAFKSQAQAYLLKPIDP
FT                   QELEQTFKQLTQLTQAQLSALPKPELLQDLKTQRHQIAAKTYRGVELIPVENIYYFLAD
FT                   QKYVTVRHKNGSVLIDETLKELETEFADQFIRIHRNALVSIAYLDGLELVSSGQYQVRL
FT                   RGLDERLSVSRRHLSTLRERIHQL"
     atgaaggtgc taatttgtga tgacgaacca cttgcagtgg aacgattgtc acgtttagtt        60
     tcaaagatgg gacatgaggt tgttgcaaca gctcatcatg gccaagatgc cttggaacag       120
     gcacggcttc atcacccaga tgtgatttta cttgatatcc agatgccggg tatgaatggt       180
     ctcgtctgtg ctgagcaatt aagccaactt aatcctcgac ctgctatagt gttttgcaca       240
     gcttatgatc agcatgcatt ggaggcattt aagtcacaag cacaagctta tcttcttaag       300
     cccattgatc ctcaagagct ggagcagaca tttaagcaat taacccagct aacacaagca       360
     cagctcagcg ctttgcctaa acctgagctt ttacaggatt taaaaacaca acgtcatcaa       420
     attgctgcta aaacctatcg tggggttgag ctaattcctg ttgaaaatat ctattacttt       480
     ttagcagatc agaaatatgt cacggtacgt cataaaaatg gcagcgtatt gattgacgaa       540
     acacttaaag aacttgaaac tgagttcgca gatcagttca tccgtattca ccgtaatgca       600
     ttggtctcga ttgcttattt agatggttta gagctagtaa gttcgggcca atatcaggtt       660
     cgcttacgtg gcttagatga aagactttcc gtaagccgcc gtcatttatc tacccttaga       720
     gaacggatac accaacttta a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page