(data stored in ACNUC29543 zone)

EMBL: CP000521.PE257

CP000521.PE257       Location/Qualifiers
FT   CDS_pept        289598..290107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10739"
FT                   /protein_id="ABO10739.1"
FT                   /translation="MWQISRTVPELQQSLLQSEQQYANLNDQLVALQRQIQNQPSHNSK
FT                   TTPLATTEVVQTGIAPTVLIKQKLELIQFAIDQQQFIYAVDHLTQLQQTLPQYGIAPAL
FT                   QHSLNQALEQDKQAIQQFVLAQNQRHQLIDDLLQNIDKNIQQALKQPKFEMDQSEAVSW
FT                   WKMVPY"
     atgtggcaaa tttctcgtac cgtccctgaa cttcagcaaa gcttgctgca atctgaacag        60
     caatatgcca atttgaatga tcaattggtt gctttgcaaa gacaaattca aaatcaacca       120
     agtcataatt ctaaaacaac gcctttagca acgactgaag ttgttcaaac cggaattgca       180
     ccgaccgtat taattaaaca aaaattagag ttaatccagt ttgcaattga ccaacagcaa       240
     tttatttatg ctgtagatca tctaacccaa ctacagcaaa ccctaccaca atatggaatt       300
     gctcctgcat tacaacacag cttaaatcag gctcttgagc aagataagca ggctattcaa       360
     cagtttgtgc ttgctcaaaa tcagcgacat caactcattg acgatttact ccagaatatt       420
     gataaaaata ttcaacaagc tttaaagcag cctaaatttg agatggacca atccgaggct       480
     gtgtcatggt ggaaaatggt tccgtattga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page