(data stored in ACNUC29543 zone)

EMBL: CP000521.PE259

CP000521.PE259       Location/Qualifiers
FT   CDS_pept        290379..291572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0266"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10741"
FT                   /protein_id="ABO10741.2"
FT                   /translation="MKHLLWVYFLISLVLFAALALFSYGYGMGYVYIYWRQLQLQTNVW
FT                   GLVLTFVVMSFIAQVIWLWIKRYSSREQRKRENIFQFKNLHPYEQLGIVWLLEAAEDQR
FT                   VFIERVFTQSGLLKNIIDAKFLVLSGDYQKALEALDQSPPMAFELAELQRIEIFLAQNE
FT                   AERALTHLEFLYQHQLSPWLEEIETAYQQRLTALWGQLALQQPWVYLRSMKYGLLDAEH
FT                   RDLWLQQLLQQFDQASIDDLQALQQRYLDLESEIQTRPYSSKLLWLKLLARMPEMSIQH
FT                   EALTLHLLKEQFDPDVFYLWFQQQLLKQVPDYADVEEKINQFESQYMNLPVLTFAKWHV
FT                   YMATGRQAEAEILLSLYPDNILMSYLRIKSTLKEDDELIKQLNLIFENDANFLKFKI"
     atgaagcatc tcctgtgggt ttacttttta attagcttag tccttttcgc agccttggct        60
     ttattcagtt atggctatgg tatgggttat gtctatattt actggcggca attgcaattg       120
     caaacaaatg tatggggatt agtccttacg tttgttgtga tgagctttat tgctcaggtg       180
     atatggctct ggattaagcg ttattcttct cgggaacaaa gaaagagaga gaatattttt       240
     cagtttaaaa atcttcatcc atatgaacaa ttaggtattg tctggttatt agaggctgct       300
     gaagatcaac gggtatttat cgaacgtgtt tttactcaat caggccttct aaaaaatatt       360
     attgatgcca aatttctagt tttaagtgga gattaccaaa aagctttaga ggccttggat       420
     caatccccac caatggcttt tgagttagca gaattacagc gtattgaaat attcttggca       480
     caaaacgaag ctgaacgtgc cttaacccat cttgagtttt tatatcagca tcagttatcg       540
     ccatggcttg aagagattga gacagcatat caacaacgtt taacggcgct ttggggccag       600
     cttgctttac aacaaccatg ggtatacttg cgttctatga aatatggttt gttggacgct       660
     gaacatcgtg atttatggtt acaacaatta cttcaacagt ttgatcaagc ttcaattgat       720
     gatttacaag cactgcaaca gcgctatctg gatttagagt cagaaattca aaccagacct       780
     tatagcagta aattgttatg gttaaaactt ttggcccgta tgccagaaat gagtattcag       840
     catgaagcat taaccttgca tttactcaaa gagcaattcg atccggacgt attttactta       900
     tggtttcagc aacaattgct taagcaggtt cctgactatg ccgatgtcga agaaaagatt       960
     aatcaatttg aatctcaata tatgaatttg ccagttttaa catttgcaaa atggcatgtt      1020
     tacatggcaa caggtcgtca agctgaagca gaaatattat taagtttata tccagataat      1080
     attttaatga gctatttacg tattaaatca accttaaaag aagatgatga gttaatcaaa      1140
     cagttaaacc taatctttga aaatgatgcg aattttttaa aatttaaaat ctga            1194
//

If you have problems or comments...

PBIL Back to PBIL home page