(data stored in ACNUC29543 zone)

EMBL: CP000521.PE263

CP000521.PE263       Location/Qualifiers
FT   CDS_pept        293615..294451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0270"
FT                   /product="putative general secretion pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10745"
FT                   /protein_id="ABO10745.2"
FT                   /translation="MKVWIDKLQQLQWQKLDRLSVVVLAILILWLCWKLASFFWLVIAP
FT                   PQLMQFDRVELGSQQPQIPNISTFSLFNEPSANAAQESVNLELQGVMVGYPNRFSSAVI
FT                   KIDNTAERYRVGETIGSTSYQLAEVYWDHVVLSQGNGSTRELQFKGLPNGLYQPMTPDA
FT                   SQQSATPSQPTEPMNTAQQALGQAIQQMQGNREQYLRDMGVSGNSGEGYEVTERTPTAL
FT                   RNKLGLRPGDRIVSLNGQTIGQGQTDVQLLEQARRAGQVKIEIKRGDQVMTIQQNF"
     atgaaagtat ggattgataa attacagcaa ttgcaatggc aaaaattaga tcgactgagt        60
     gtagtggtcc ttgccatttt aattttatgg ttatgctgga aactcgcttc atttttttgg       120
     ttggtgattg cgcctcctca actgatgcaa tttgatcggg tagaactcgg ttctcaacaa       180
     ccacaaatac caaatattag tactttttca ctttttaacg aaccttctgc caatgcggct       240
     caagaaagcg tgaatttaga attgcagggt gtaatggtcg gctatccaaa ccggttttcc       300
     tctgctgtta ttaaaattga taatactgct gagcgttatc gagttggtga aaccattggt       360
     tcaacttctt accaattggc agaggtgtat tgggatcatg ttgtgttgag tcaaggaaat       420
     ggcagtaccc gtgaacttca gttcaaaggt ttgccaaatg gtttgtatca accaatgact       480
     ccggatgctt cacaacaaag tgctacaccg tctcaaccta cagagcctat gaatacggcc       540
     caacaggcat tgggacaagc gatccagcag atgcaaggta accgagagca atacctccga       600
     gatatggggg taagtggtaa ctcaggtgaa ggctatgaag ttacagaacg tacaccgact       660
     gcacttagaa ataagttagg tttaaggcct ggcgatcgaa ttgtctcttt gaatggtcaa       720
     acgattgggc aagggcaaac ggatgtgcaa ttacttgagc aggctcgtcg agcagggcaa       780
     gtaaaaatag aaataaaacg tggtgatcaa gtgatgacca tacaacaaaa tttttag          837
//

If you have problems or comments...

PBIL Back to PBIL home page