(data stored in ACNUC29543 zone)

EMBL: CP000521.PE264

CP000521.PE264       Location/Qualifiers
FT   CDS_pept        294493..296769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0271"
FT                   /product="putative general secretion pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10746"
FT                   /protein_id="ABO10746.2"
FT                   /translation="MALLNHQRPLWALLAAAPLIATVTSSAYAQTWKINLRDADLTAFI
FT                   NEVADITGKNFAVDPRVRGNVTVISNKPLNKDEVYDLFLGVLNVNGVVAIPSGNTIKLV
FT                   PDSNVKNSGIPYDSRNRVRGDQIVTRVIWLENTNPNDLIPALRPLMPQFAHMAAIAGTN
FT                   ALIISDRAANIYQLENIIRNLDGTGQNDIEAITLQSSQAEEIITQLEAMSATGASKDFS
FT                   GARIRIIADNRTNRILIKGDPQTRKRIRHMIEMLDVPSADRLGGLKVFRLKYASAKNLS
FT                   EILQGLVTGQAVSSSNNSNNSSNSSNPINSLIGNNQNSGSNTSGSNGASISTPAINLNG
FT                   NSNSSNQNNITSFNQNGVSIIADNAQNSLVVKADPQLMREIESAIQQLDVRRQQVLIEA
FT                   AIIEVSGDDADQLGIQWALGDLSSGIGLLSFSNVGASLSSIAAGYLSGGSAGAASAIAN
FT                   GANKGNGATLGLGNFDNSRKAYGALIQALKTNTKSNLLSTPSIVTMDNEEAYIVVGQNV
FT                   PFVTGSVTTNSTGINPYTTVERKDVGVTLKVVPHIGEGGTVRLEVEQEVSAVQDSRGQA
FT                   ADLVTSKRAIKTAVLAEHGQTVVLGGLVSDDTSLSRQGIPGLSSIPYVGRLFRSDNRSN
FT                   VKRNLLVFIHPTIVGDANDVRRLSQQRYNQLYSLQLAMDKNGNFAKLPEQVDDIYNQKM
FT                   TPPSIASKPKNYQQVPSGGKSSTITTPVAVEPTVQKQTLQLPDPEINRTKNTVTTTTLR
FT                   PSTAP"
     atggctttat tgaatcatca acgtccactt tgggcattac ttgcagccgc cccattgatt        60
     gcgacagtaa ctagcagtgc ctatgcccaa acatggaaga tcaatttacg tgatgctgac       120
     ttaactgcct ttattaatga agttgcagac attacaggaa agaacttcgc tgtagatccg       180
     agagtacgtg gtaatgtcac ggttatttct aataagccat taaataaaga tgaagtttat       240
     gacctatttc ttggggtctt aaatgtaaac ggggtggttg caattccgtc tggtaatacc       300
     attaagcttg taccggatag caatgttaaa aactcgggaa ttccttatga ttctagaaat       360
     agagttcgtg gtgatcaaat cgttacacgt gtgatttggc tggaaaatac taatccaaat       420
     gacttaattc cagcactccg tcccttaatg ccgcaatttg cacatatggc ggcaattgca       480
     ggaaccaatg cacttattat ttctgataga gctgcgaata tttatcaact tgaaaatatt       540
     attcgtaact tggatggaac tgggcaaaat gatattgaag cgatcacgct tcagtcgagc       600
     caagcagaag aaattattac ccagcttgaa gcgatgagcg caacaggcgc atctaaagat       660
     tttagtggtg cccgtattcg tattattgct gataatcgga caaaccgtat tttaataaaa       720
     ggtgatccgc aaacacgtaa acgtattcgt catatgattg agatgctgga tgtaccttcg       780
     gcagatcgtt taggtggctt aaaagttttc cgtttgaagt atgccagtgc taaaaacttg       840
     tctgaaattt tgcaaggctt agtcacagga caggcagtat cttcatcgaa taatagtaat       900
     aattcatcta actcatcgaa tccgattaat agtttaattg gtaataacca gaattctggt       960
     tcaaatacat cgggttcaaa tggcgcctca atttcaactc ctgcaattaa cctaaacggt      1020
     aattcgaaca gtagtaatca gaataatatc accagcttta atcaaaacgg tgtgagtatt      1080
     attgcagata atgctcagaa ctcattagta gttaaagctg atccccaatt aatgcgtgaa      1140
     attgaatcag cgattcaaca actagacgtt cgtcgtcaac aagtgcttat tgaggccgca      1200
     attattgaag tctctggaga tgatgcagat caacttggaa ttcaatgggc actcggtgat      1260
     ttatctagtg ggattggttt acttagcttt agtaatgtag gggcgagttt atcttctatt      1320
     gctgctggtt atttatcggg tggttcggct ggagctgcat ctgctatcgc taatggagct      1380
     aataaaggta atggtgcaac tttaggattg ggcaattttg ataactctcg taaggcatat      1440
     ggtgcattaa ttcaggctct caaaaccaat acaaaatcaa acttactttc gacaccgtct      1500
     attgtgacga tggataatga agaagcttat attgttgtag gtcagaacgt tccatttgta      1560
     acaggttcgg tcactaccaa tagtacaggt attaatccct atacaactgt ggagcgtaaa      1620
     gatgtcggtg tgaccttgaa agttgttcca catatcggtg aaggtggtac agttcgttta      1680
     gaggtagagc aagaagtttc tgctgttcaa gatagccgcg ggcaagcagc tgacttggtg      1740
     acaagtaaac gcgctattaa aacagctgtt ttagccgagc atgggcagac tgtggtgcta      1800
     ggtggattgg tgtcggatga cacttcgctt tcaagacaag gtatacctgg tttaagtagt      1860
     attccttatg ttgggcgatt gttccgatca gataacagaa gcaatgtaaa acgtaacctt      1920
     ctcgttttta ttcacccaac aattgtaggc gatgcaaatg atgtacgccg tttatctcag      1980
     cagcgctata atcaacttta tagcttgcaa ttggctatgg ataaaaatgg caactttgca      2040
     aaattacctg agcaagttga tgatatttat aaccaaaaaa tgaccccgcc gagtattgcc      2100
     tctaagccaa aaaattacca acaggttcca tcaggtggta aaagttcgac cataactacg      2160
     ccggtagctg tagaacctac cgtccaaaag caaacactac agttgcctga tcctgaaatt      2220
     aatcgtacta aaaatacagt aacaacaacg acactgcgtc caagcacagc gccgtag         2277
//

If you have problems or comments...

PBIL Back to PBIL home page