(data stored in ACNUC29543 zone)

EMBL: CP000521.PE269

CP000521.PE269       Location/Qualifiers
FT   CDS_pept        301855..302295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0281"
FT                   /product="preprotein translocase IISP family membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10751"
FT                   /protein_id="ABO10751.2"
FT                   /translation="MSNDKSRDALSDAPIPQRNNSAEVVRSGSPLDIVLWVIAIALLLS
FT                   ATMVNQHLPAYWAPANDVWVRVGVIFACIVVALGLLYATHQGKGFVRLLKDARVELRRV
FT                   TWPTKQETVTTSWQVLLVVVVASLVLWCFDYGLGWLIKLIIG"
     atgtcgaatg ataaatcgcg tgacgcattg agcgacgcgc caattcctca aagaaataat        60
     tctgctgaag ttgttcgttc tggttcgcct ttagatatcg ttctatgggt gatagcaatt       120
     gcattattgc tctcggctac catggtgaat cagcatttac cagcgtattg ggcccctgca       180
     aatgatgttt gggtgcgcgt tggggtaatt tttgcttgta tcgttgtggc tttaggttta       240
     ttatacgcca cccatcaagg taaaggcttc gttcgtttgc tgaaagatgc acgagtcgaa       300
     ttgcgtcgag taacttggcc aacaaaacaa gaaacagtca caacatcgtg gcaggttcta       360
     ttggttgtag ttgtggcatc attagtttta tggtgttttg actatggttt gggttggtta       420
     attaagttga ttatcgggta a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page