(data stored in ACNUC29543 zone)

EMBL: CP000521.PE27

CP000521.PE27        Location/Qualifiers
FT   CDS_pept        complement(34317..35114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0027"
FT                   /product="alkanesulfonate transport protein"
FT                   /note="ABC superfamily membrane"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10522"
FT                   /protein_id="ABO10522.2"
FT                   /translation="MSKDINIVSRGTKQVGQRLLPWIFPIVLLVVWQIASSSGLLENRI
FT                   LPAPTAVVSAFWHLLISGELWQHVKVSAGRALLGLFIGGGLGLLLGLLNGSSRFASTLL
FT                   DTTLQMIRNIPALALIPLVILWFGIDETAKLFLVAVGVFFPIYINTYHGIRSVDPQLIE
FT                   MGKSYGLSRWQLYKEIILPGAMPSILVGLRFALGLVWVLLIVAETISAQAGIGYMTMNA
FT                   REFLQTDVVLVGILLYALLGKLADVLAQLLERYLLRWHAGYQK"
     atgagcaaag atataaatat tgtttcacgt ggaacgaagc aagtcgggca gcgtctgctg        60
     ccttggattt tcccgattgt tctattagtt gtttggcaaa ttgcgtcaag ttcaggcctt       120
     ttagaaaatc gtattctgcc ggctcctacg gctgttgttt ctgccttttg gcatctactc       180
     attagcggtg agctttggca acacgttaaa gtcagtgcag gacgggcctt actcgggcta       240
     tttattggtg gtggtttagg tttgctattg ggtctgctca atgggtcttc tcgtttcgcc       300
     tccaccctgc tcgatacaac cttgcaaatg attcgtaaca tcccagcatt agcacttatt       360
     ccactggtta tcttgtggtt cggtattgat gaaacagcca aattattttt ggtggcggtc       420
     ggagtcttct tccctattta tatcaacacc tatcacggta tccgttcagt cgatccacaa       480
     ttaattgaga tgggtaaaag ctatggtctt tcacgttggc agctttacaa agaaattatt       540
     ctaccgggtg cgatgccctc tattttagtt ggtttacgtt ttgctttagg tctggtttgg       600
     gtgttgctca ttgtagctga gactatttca gcacaagcag gtattggcta tatgactatg       660
     aatgcacgag agtttttgca aactgatgtg gttctggtcg gtattcttct ttatgcccta       720
     ttaggcaaat tagccgatgt tctagcgcaa cttttggaac gttatttact acgctggcat       780
     gccggttatc aaaaataa                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page