(data stored in ACNUC29543 zone)

EMBL: CP000521.PE270

CP000521.PE270       Location/Qualifiers
FT   CDS_pept        302303..302836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0282"
FT                   /product="transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10752"
FT                   /protein_id="ABO10752.2"
FT                   /translation="MKRWYIIHAYSGYEKQVMRSLKERIQRSAVADSFGDVLVPTEEVV
FT                   EMKDGKKRKSERKFFPGYVLVEMEMNDDTWHIVKECPKVLGFIGGTPEKPAPITQREAD
FT                   AILARVRNTGEAPRPKTMFEPGEELLVIDGPFTDFKGVVEEVQYDKSRLTLTINVFNRP
FT                   TQVELEFRQVEKTI"
     atgaaacgtt ggtacattat tcatgcctat tctggttatg aaaaacaagt gatgcgttca        60
     cttaaagaac gaatccagcg tagcgctgtt gccgatagct ttggtgatgt ccttgttcct       120
     accgaagaag tggtagaaat gaaggatggt aagaagcgta aatctgagcg taaattcttt       180
     cctggctatg tgttggttga aatggaaatg aatgacgata cttggcacat tgttaaagag       240
     tgtccaaaag tattaggttt tattggtggt acacctgaaa aacctgcgcc aatcactcaa       300
     cgtgaagcag atgcgattct tgcgcgtgta cgtaatactg gtgaagcccc acgtcctaag       360
     acgatgtttg agccaggtga agaattactt gttattgacg gtccattcac agactttaaa       420
     ggtgtggtgg aagaggttca atacgataag tcacgtttaa cgttgacgat taacgtgttt       480
     aatcgaccaa ctcaggttga actcgaattt cgccaagtcg aaaaaacgat ttaa             534
//

If you have problems or comments...

PBIL Back to PBIL home page