(data stored in ACNUC29543 zone)

EMBL: CP000521.PE271

CP000521.PE271       Location/Qualifiers
FT   CDS_pept        302945..303373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0283"
FT                   /product="50S ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10753"
FT                   /db_xref="GOA:A3M1F9"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1F9"
FT                   /protein_id="ABO10753.2"
FT                   /translation="MAKKIDGYIKLQVPAGKANPSPPIGPALGQRGVNIMAFCKEFNAA
FT                   TQKVEPGLPIPVVITVYNDKSFTFIMKTPPASILLKKAAGIQKGSSVPNKTKVGKLTRA
FT                   QLEEIATTKEPDLTGADLDARVRTIAGSARSMGLEVEL"
     atggctaaga agattgacgg ctatatcaag ctgcaagttc cagctggtaa agcaaatcca        60
     tctccaccga ttggtcctgc actaggtcaa cgtggtgtaa acatcatggc attctgtaaa       120
     gaattcaatg ctgctacaca aaaagttgaa ccaggtcttc caatccctgt agtgattact       180
     gtgtacaacg acaagtcgtt cacattcatc atgaaaactc ctccagcttc tattcttctt       240
     aagaaagctg ctggtatcca aaagggttca tctgtaccta acaaaactaa agttggtaag       300
     ttgactcgtg ctcaattaga agaaatcgcg actactaaag aaccagactt aactggtgct       360
     gacttagacg cgcgtgttcg taccatcgct ggttctgcac gttctatggg cttggaagtg       420
     gagctataa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page