(data stored in ACNUC29543 zone)

EMBL: CP000521.PE272

CP000521.PE272       Location/Qualifiers
FT   CDS_pept        303377..304072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0284"
FT                   /product="50S ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10754"
FT                   /db_xref="GOA:A3M1G0"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1G0"
FT                   /protein_id="ABO10754.2"
FT                   /translation="MAKLTKRQKAIAAAVEANKVYTLEEAVQVLNSLPAAKFKESLDIS
FT                   VNLGVDPRKSDQVVRGATTLPAGTGKTVRVAVFAQGAQAEAAKEAGADVVGFDDLAESI
FT                   QGGNLDFDVVIAAPDAMRVVGKLGTILGPRGLMPNPKVGTVTPDVAGAVKNAKSGQARY
FT                   RVDKAGIIHAAIGQVGFDAAAIRQNVETLVADLKKLKPATSKGVYIKKITLSSTMGPGL
FT                   TVDVNNVSN"
     atggcaaagt taactaaacg tcaaaaagcc attgctgctg ctgttgaagc gaacaaagtt        60
     tacactttgg aagaagcagt acaggttctt aatagcttgc ctgctgcaaa gttcaaagaa       120
     tctttagaca tctctgtaaa ccttggcgta gatccacgta aatctgatca ggttgttcgt       180
     ggtgcgacta cattacctgc aggtactggt aaaactgtac gtgtagctgt atttgctcaa       240
     ggcgcgcaag cagaagctgc gaaagaagct ggtgctgatg ttgtaggttt tgatgacctt       300
     gctgaaagca tccaaggcgg aaaccttgac tttgatgttg taatcgctgc tcctgacgct       360
     atgcgtgttg ttggtaagct cggtacaatt cttggtccac gtggtttaat gccaaaccct       420
     aaagttggta ctgtaactcc tgacgttgct ggcgctgtta aaaacgctaa atctggtcag       480
     gcgcgttacc gtgtagacaa agcgggtatt attcacgctg cgattggtca agttggcttt       540
     gatgctgctg caatccgtca aaacgttgaa actttagttg ctgacttgaa aaagttaaaa       600
     cctgcaactt ctaaaggtgt atacatcaag aagatcactt tgagctcaac tatgggtcct       660
     ggtcttactg ttgatgtaaa caacgtttct aactaa                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page