(data stored in ACNUC29543 zone)

EMBL: CP000521.PE273

CP000521.PE273       Location/Qualifiers
FT   CDS_pept        304392..304898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0285"
FT                   /product="50S ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10755"
FT                   /db_xref="GOA:A3M1G1"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1G1"
FT                   /protein_id="ABO10755.2"
FT                   /translation="MALLIEDKKQIVAEVSEVASKAFAAVVADYQGLSVEQLTTLRVEA
FT                   RKLGVTTRIVRNTLAKRAFQGTQFDILNDNLVGPTILGFSTSEDDMGAAARLFEEFAKT
FT                   NKAFELKAAAFDGKVYQGADVSVIANLPNQEKALTMLASVLQAPISKLGRLITALKEKN
FT                   ESEAA"
     atggctcttc ttattgaaga caaaaaacag atcgttgcag aagtaagtga agttgcttct        60
     aaagcgtttg cagccgttgt tgctgactat caaggtttaa gcgtagagca attaacaaca       120
     cttcgtgttg aagctcgtaa gttaggtgta actacacgta ttgtacgtaa cactttggct       180
     aaacgcgcat ttcaaggtac tcagtttgat atcttgaacg acaaccttgt tggtccaaca       240
     attctaggtt tttcaacttc tgaagatgac atgggtgcag ctgcacgctt gttcgaagaa       300
     tttgctaaaa ctaacaaagc atttgaatta aaagctgctg catttgacgg caaagtttat       360
     caaggtgctg atgttagcgt tattgctaat cttccgaacc aagagaaagc gcttactatg       420
     cttgcctctg tccttcaagc tcctatttcg aaattgggtc gcctcattac agcactcaaa       480
     gagaaaaacg agtcagaagc tgcttaa                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page