(data stored in ACNUC29543 zone)

EMBL: CP000521.PE274

CP000521.PE274       Location/Qualifiers
FT   CDS_pept        304941..305312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0286"
FT                   /product="50S ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10756"
FT                   /db_xref="GOA:A3M1G2"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1G2"
FT                   /protein_id="ABO10756.1"
FT                   /translation="MALTNEEILNAVAEKTVLELVELISAFEEKFNVSAAAVAVAAPAG
FT                   GAAAAAEEQSEFNVELTSFGANKVAVIKAVREATGLGLKEAKDLVEGAPQVLKEGVSKE
FT                   EGEELKKKLEEAGATVTLK"
     atggctttaa ctaacgaaga aatcttaaat gcagttgctg aaaaaactgt tcttgaactt        60
     gttgaattaa tttctgcttt cgaagagaaa ttcaacgtat ctgcagctgc tgtagctgtt       120
     gctgctccag ctggtggcgc tgctgctgct gctgaagaac aatctgaatt caacgttgag       180
     ttgacttctt tcggtgctaa caaagtagct gtaattaaag ctgttcgtga agcaactggt       240
     cttggtctta aagaagctaa agacttagtt gaaggcgctc ctcaagttct taaagaaggc       300
     gtttctaaag aagaaggcga agaacttaag aagaaacttg aagaagctgg tgctacagtt       360
     acacttaagt aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page