(data stored in ACNUC29543 zone)

EMBL: CP000521.PE276

CP000521.PE276       Location/Qualifiers
FT   CDS_pept        309792..313985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0288"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /note="Transcriptase beta' chain; RNA polymerase beta'
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10758"
FT                   /db_xref="GOA:A3M1G4"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1G4"
FT                   /protein_id="ABO10758.2"
FT                   /translation="MKDLLDIMRKKTDSDGHAPVEFDRIRIGLASPEMIKSWSHGEVKK
FT                   PETINYRTFKPERDGLFCAKIFGPVKDYECLCGKYKRMKYKGVICEKCGVEVTTAKVRR
FT                   ERMGHIELASPVAHIWFLKSLPSRIGLLLDMTLRDIERVLYFESYVVTDPGMTPFEKYQ
FT                   LLNDEEYFTALEEHGDEFVAKMGAEAVQDLLKDIDLEAEISRLREEIPQTTSETKLKKA
FT                   SKRLKLMEAFKDSNNKPEWMVMNVLPVLPPDLRPLVPLEGGRFATSDLNDLYRRVINRN
FT                   NRLKRLLDLAAPDIIVRNEKRMLQESVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQ
FT                   GRFRQNLLGKRVDYSGRSVITVGPTLRLHQCGLPKKMALELFKPFIFAKLQASGQATTI
FT                   KAAKKMVERETPEVWDVLASVIRQHPVMLNRAPTLHRLGLQAFEPILIEGKAIRLHPLV
FT                   CAAFNADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVLGLYY
FT                   ITRDAVNAKGEGMVFADTHEVNRALATGQVAIHARVKVRVHQTVINENGEREQQTIIVD
FT                   TTPGRCLLWEVVPEGLSFDMINLEMTKKNISKLINSCYRKLGLKDTVIFADQLMYLGFR
FT                   QATRSGVSVGMEDMLIPPTKHTIIDKAETEVREIEQQFEQGFVTAGERYNKVVDIWART
FT                   NDQVAKAMMDNLSYTLVKNKQGEDEKQKSFNSIYMMSDSGARGSAAQIRQLAGMRGLMA
FT                   KPDGSIIETPIKANFREGLTVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDL
FT                   VITEPDCGTSGGLVMTPFIQGGDVIEPLRDRVLGRVTAEDVRRASDDEVVLPRGTLIDE
FT                   KIAAQLEEAGVDEVKVRSVIACESTFGVCAKCYGRDLARGHLVNPGESVGVMAAQSIGE
FT                   PGTQLTMRTFHVGGAASRTSAANSVQVRNKGTVRFHNVKTVQHAKGHLVSVSRSGEIGI
FT                   ADELGRERERYKLPYGASILLKDGELVEAGGIVATWDPHTHPLVTEVAGKARFSQIADG
FT                   VTATSKTDDATGMTTVEILPVTARPASGKDLRPAIVLDTTDGGEQFYFLPQNTIVTVRD
FT                   GETIGVGDVIGRVPQESSRTRDITGGLPRVADLFEARKPKEHAILAEVSGIVSFGKETK
FT                   GKNRLVITPDDGSEIYEELIPKWRQINVFEGEHVNRGETISDGPQNPHDILRLKGEVAL
FT                   TNYIVNEVQDVYRLQGVKINDKHIEVIVRQMLRKVDIIDGGDTSFIKGEQVDYIRVVQE
FT                   NQAVLAQNKFPAKFERQLMGITKASLSTDSFISAASFQETTRVLTEAAVTGKEDDLRGL
FT                   KENVVVGRLIPAGTGLAYHLERRRQEAEAAEHALHNDFSEVDQAFSQALNSEQF"
     ttgaaagact tgctcgatat catgcgtaag aaaacggact cagatggtca tgcaccagtt        60
     gagttcgacc gtatccgtat tggtcttgcg tcaccagaaa tgattaagtc atggtctcat       120
     ggtgaagtta aaaaacctga gacaatcaac tatcgtacgt tcaaaccaga acgtgatggt       180
     ttgttctgtg ccaaaatctt tggtccagta aaagattacg aatgcttgtg tggtaaatac       240
     aagcgtatga aatacaaagg cgtcatttgt gaaaaatgtg gcgttgaagt aactacagca       300
     aaagttcgtc gtgaacgtat gggtcacatt gagcttgctt ctccagttgc acatatctgg       360
     ttcttaaaat cgttaccatc ccgtatcggt ttattacttg atatgacact tcgtgatatc       420
     gaacgtgtat tgtatttcga atcatacgtt gttactgatc ctggtatgac accatttgaa       480
     aagtatcaac ttcttaatga tgaagaatac tttactgctc tagaagagca cggcgacgaa       540
     tttgttgcaa aaatgggtgc agaagcagtt caagacttgt tgaaagacat cgaccttgaa       600
     gctgaaattt cacgtttacg tgaagaaatt cctcaaacaa cttctgaaac gaagttgaaa       660
     aaagcgtcta agcgcttgaa attgatggaa gcattcaaag actcaaacaa caagccagaa       720
     tggatggtaa tgaacgtact tccggtactt ccaccagatt tacgtccatt agttccactt       780
     gaaggtggtc gtttcgcgac ttctgacttg aacgacttat atcgtcgtgt aattaaccgt       840
     aacaaccgtt tgaagcgtct tcttgacctt gcagcgccgg acatcatcgt acgtaacgaa       900
     aaacgtatgt tacaagagtc tgtagatgca ttgcttgata acggtcgtcg tggtcgtgca       960
     attactggtt ctaacaaacg cccattaaaa tctttggcag atatgatcaa aggtaaacaa      1020
     ggtcgtttcc gtcagaactt gttaggtaag cgtgttgact actctggtcg ttcggtaatt      1080
     actgtaggtc ctactttacg tcttcaccaa tgtggtcttc cgaagaaaat ggcacttgaa      1140
     ttattcaagc cattcatttt cgcgaaatta caagcttcag gtcaggcaac aaccattaaa      1200
     gctgcgaaga aaatggttga acgtgagact ccggaagttt gggacgttct tgcatctgta      1260
     attcgtcaac atccagtaat gttgaaccgt gcgccaacac ttcaccgttt aggtcttcaa      1320
     gcatttgaac ctattcttat tgaaggtaag gcaatccgtc ttcacccgct cgtctgtgct      1380
     gcgttcaacg ccgacttcga cggtgaccaa atggcggtac acgttccatt gacacttgaa      1440
     gcacagttag aagctcgtgc attgatgatg tcaacaaaca acatcttgtc accagcaaac      1500
     ggtgagccaa tcatcgttcc ttctcaggac gttgtcttgg gtctttacta catcactcgt      1560
     gatgcagtaa atgcgaaagg tgaaggcatg gtgtttgcgg atactcacga agtaaaccgt      1620
     gcacttgcaa ctggtcaagt tgcgatccat gctcgtgtta aagtacgtgt gcatcaaaca      1680
     gttatcaatg aaaatggtga gcgtgaacag caaactatta ttgttgatac aacaccaggt      1740
     cgttgcttac tttgggaggt tgttccagaa ggtttaagct ttgacatgat caaccttgag      1800
     atgactaaaa agaacatctc taagttaatc aactcttgct accgtaaact tggtttgaaa      1860
     gatacagtta tcttcgctga ccaattaatg tacttgggct tccgtcaagc gactcgttca      1920
     ggtgtatctg taggtatgga agacatgtta attccaccta cgaaacacac aattattgac      1980
     aaagcggaaa cagaagttcg tgaaatcgaa caacagttcg aacaaggttt cgtaactgct      2040
     ggtgaacgtt ataacaaagt tgtcgatatt tgggcgcgta caaacgacca agttgctaaa      2100
     gcaatgatgg ataacttgtc ttatacactt gtgaaaaaca aacaaggtga agacgagaag      2160
     caaaaatcat tcaacagtat ctatatgatg tctgactctg gtgcccgtgg tagtgcggct      2220
     cagattcgtc agcttgcagg tatgcgtggt ttgatggcaa aaccggatgg ctcgattatt      2280
     gagactccaa ttaaagcgaa cttccgtgaa ggtttgacag tactccagta cttcatttca      2340
     acacacggtg cgcgtaaagg tttggccgat actgcattga aaactgcgaa ctctggttac      2400
     ttgactcgtc gtcttgtaga cgtagcacaa gacttagtaa ttactgagcc agattgtggt      2460
     acaagtggtg gtctagtgat gactccattc attcagggtg gtgatgtcat cgagccatta      2520
     cgtgaccgcg tattaggtcg tgtaactgct gaagatgtac gtcgtgcatc tgatgatgaa      2580
     gttgtattac ctcgcggtac gttaattgac gagaaaatcg cagctcagct tgaagaggct      2640
     ggtgtcgatg aagttaaagt acgttctgta atcgcatgtg aatcaacatt cggtgtatgt      2700
     gcgaaatgtt atggtcgtga cctcgctcgt ggtcacttgg taaacccagg tgagtcagta      2760
     ggtgtaatgg ctgcacagtc aatcggtgaa ccaggtacac agttaacaat gcgtacgttc      2820
     cacgtgggtg gtgctgcaag ccgaacttct gctgcaaaca gtgttcaagt acgtaacaaa      2880
     ggtactgtac gtttccataa cgtaaaaact gtacaacatg cgaaaggcca cttggtttca      2940
     gtttcacgtt caggtgaaat tggtattgcc gatgagttag gccgtgagcg tgaacgctac      3000
     aaacttcctt acggtgcgag catcttgttg aaagatggtg agcttgttga ggcgggtggt      3060
     atcgttgcga catgggatcc gcatacgcat ccattagtaa cagaagttgc tggtaaagca      3120
     cgtttcagcc aaattgctga tggtgtaact gcaacatcga aaactgatga tgcaactggt      3180
     atgacaactg ttgaaatctt gcctgtaaca gcacgtcctg cttctggtaa agatttacgt      3240
     ccagcaatcg tattagatac aactgatggc ggtgaacagt tctacttctt accacaaaac      3300
     acaattgtga ctgttcgcga cggcgaaaca attggtgtgg gtgacgttat cggtcgtgta      3360
     ccacaagaat cttcacgtac tcgtgatatt accggtggtc ttccgcgtgt tgctgacttg      3420
     ttcgaagcac gtaagccgaa agagcatgcg atcttagcag aagtgtctgg tatcgtaagc      3480
     ttcggtaaag agaccaaagg taagaaccgt ttagtgatta ctccagatga cggttctgaa      3540
     atttacgaag agttgattcc aaaatggcgt caaatcaacg tgtttgaagg tgaacatgtg      3600
     aaccgtggtg aaaccatttc tgatggtcca caaaatccac atgacatctt acgtttgaaa      3660
     ggtgaagttg ctttaactaa ctacatcgtg aacgaagttc aagacgttta ccgtctccaa      3720
     ggtgtaaaaa tcaacgataa gcacattgaa gttatcgtac gtcaaatgtt gcgtaaagtt      3780
     gatatcatcg atggtggtga tacaagcttc atcaaaggtg aacaagtgga ttacatccgt      3840
     gttgttcaag agaaccaagc tgtcttggct cagaacaagt tccctgcgaa gtttgaacgt      3900
     caattgatgg gtattacgaa agcatcgctt tctactgact cgttcatctc tgctgcatcg      3960
     ttccaggaaa caactcgtgt gttaactgaa gctgctgtaa caggtaaaga agatgattta      4020
     cgtggcttga aagaaaacgt tgttgtgggc cgcttgattc cagctggtac tggtcttgca      4080
     taccacttag agcgtcgtcg tcaagaagcg gaagcagcag aacatgctct tcacaatgac      4140
     ttcagtgaag tagaccaagc atttagccaa gctttaaact cagaacaatt ctaa            4194
//

If you have problems or comments...

PBIL Back to PBIL home page