(data stored in ACNUC29543 zone)

EMBL: CP000521.PE279

CP000521.PE279       Location/Qualifiers
FT   CDS_pept        complement(315117..315614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10759"
FT                   /protein_id="ABO10759.2"
FT                   /translation="MAILKKLQNIPSISKFLFNHYPPYRGAGIYIEVMNLELCHVRVKM
FT                   PLTWKNQNLVGTHFGGSLYSMVDPFYMLILMHHLGSKYIVWDKAAEINFLSPGRSTVYA
FT                   DIRVDLAEIEQIRELAENYAPVLRTYHLNIFDESGVRIAEVQKTLYIRRKKAKPSTNKI
FT                   SA"
     atggctattt taaaaaaact tcagaacatt ccttcaattt ccaaattctt atttaaccat        60
     tacccacctt accgtggcgc agggatttat attgaagtca tgaatttaga gctctgtcat       120
     gttcgggtaa aaatgccact tacttggaaa aatcaaaatc tggtaggcac tcactttggc       180
     ggaagccttt attcaatggt tgaccccttt tatatgttga ttcttatgca tcatctcgga       240
     tcaaaatata ttgtttggga taaagcagct gaaattaatt ttttatcacc tggccgaagt       300
     accgtttatg ctgacattcg cgttgattta gcagaaattg aacaaattcg tgaacttgcc       360
     gaaaactatg ctcctgttct tagaacatat catttaaata ttttcgatga atcaggtgtg       420
     agaattgctg aagtccaaaa gacactttat atccgacgta aaaaagcaaa gccttctact       480
     aataaaataa gcgcctga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page