(data stored in ACNUC29543 zone)

EMBL: CP000521.PE280

CP000521.PE280       Location/Qualifiers
FT   CDS_pept        315738..316610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10760"
FT                   /protein_id="ABO10760.2"
FT                   /translation="MQPKIYAVTTSDQQTLCAKAWGDEKNTPLVLVHGYPDNQEVWESV
FT                   IEHLINDFYIVTYDVRGAGLSSIPKRIRDYRLERLSLDLQEVVDEVIPNRQFHMAAHDW
FT                   GSIQSWESATEPKFKGRLLSYTTISGPCLDHAALFLREKFKTSPAQILKILTKSWYIGA
FT                   FHLPLIAPTVWSLFSPEKWGKILKDLERKDNLPLNSNISSDGKYGINLYRANFIPRLTS
FT                   PRQRYAQCPVKAIILKYDTFVSPEYITEAMPKWVENFEYVELEANHWAILSQAEKVAAH
FT                   IRQFIDSQS"
     atgcagccaa agatttatgc cgtaacgaca agtgatcaac aaaccctgtg tgccaaagct        60
     tggggtgatg agaaaaatac tccattagtg ttagtgcatg gttatccaga taatcaggaa       120
     gtatgggaat cggtcattga gcatttaatc aatgattttt atattgtgac ttatgatgtc       180
     cgtggggcag gcttatcctc tattcctaaa cggatacggg attaccgttt agaacgttta       240
     tctttagatt tgcaggaagt cgtagatgag gtaatcccaa atcgacagtt ccatatggct       300
     gcgcatgatt ggggttcaat tcagtcttgg gaatctgcaa cagaacctaa atttaaaggc       360
     cgtttactct cttatacaac aatttccggt ccatgtttgg atcatgcggc acttttctta       420
     agagagaagt tcaaaacatc acctgcacag atcctaaaaa tactcacaaa atcatggtat       480
     atcggagcat tccatttacc gctaattgct ccaactgtat ggtcgctgtt tagtccagag       540
     aagtggggta agatcttaaa agatttagag cgaaaagata atttgccatt aaatagtaat       600
     atttcctcag atgggaaata cggtattaac ttatatcgtg cgaattttat tccacgttta       660
     actagccctc gtcagcgtta tgcgcaatgt ccagttaaag caattatttt aaaatatgac       720
     acttttgtca gcccagaata tattacagaa gcgatgccaa aatgggttga aaacttcgaa       780
     tatgttgagc ttgaagcaaa tcattgggcg attttgagtc aggctgaaaa agtggcagct       840
     catattcgcc aatttattga ctcgcagagc taa                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page