(data stored in ACNUC29543 zone)

EMBL: CP000521.PE282

CP000521.PE282       Location/Qualifiers
FT   CDS_pept        318464..319045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0292"
FT                   /product="putative outer membrane protein W"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10762"
FT                   /protein_id="ABO10762.2"
FT                   /translation="MFKKALVIALMGVSSFTFAGNWQVKFGGSVIAPSEDTTTALGVVK
FT                   ADHEYAFTPSVEYFFGQSPFSAELLLATPVNHDVLLDGQKVARIKQLPPTITAKYHFKN
FT                   STRFTPYIGIGATAFIPWDEQGVADKVKEDFGVAGQIGFNFQPADAKNWGVFVDVRYAD
FT                   ISPEVTLTNGAKFDLDINPFVYTLGYSYKF"
     gtgttcaaaa aagcattagt tattgcatta atgggggtgt cttcatttac ttttgctggt        60
     aattggcaag taaaatttgg gggcagcgtt attgctccat cggaagatac aacaactgct       120
     ttaggtgtgg taaaggcgga ccatgaatat gcatttactc catcagtaga atactttttt       180
     ggtcaatctc cattttcggc agaattatta ttagcaacgc cggttaatca tgatgtttta       240
     ttagatggtc agaaagtagc gcgtattaaa caattgccac caacaattac cgcgaaatat       300
     cattttaaaa actcgactcg ttttacaccg tatattggta tcggggcaac agcatttatt       360
     ccttgggatg aacaaggcgt agctgacaaa gtaaaagaag attttggtgt ggctggccaa       420
     attggtttta atttccaacc tgctgatgct aaaaattggg gagtatttgt agatgttcgt       480
     tatgcagata ttagtccaga agttacttta acaaatggtg ctaaatttga cttagatatt       540
     aacccgtttg tttacacttt aggctatagc tataaattct aa                          582
//

If you have problems or comments...

PBIL Back to PBIL home page