(data stored in ACNUC29543 zone)

EMBL: CP000521.PE295

CP000521.PE295       Location/Qualifiers
FT   CDS_pept        336585..337115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10775"
FT                   /protein_id="ABO10775.2"
FT                   /translation="MAHAHHAAHAYVHHIKVRKEESSQGDLKTKAMLSKASSGNKKLHR
FT                   PASKRHKSEDQNIDLHKFSSKLESMSAKHSKEKCAKNIRIALQAAGADVSKHPVAASDW
FT                   GQTLEKNGYKKIKPAFNRPQEGDIYIIERTSGHTYGHIAGYTGNGWFSDFRQKTYAVYK
FT                   EKDVKYSYYRLDS"
     atggctcatg ctcatcacgc agctcatgca tatgttcacc atatcaaagt gagaaaagaa        60
     gaaagctctc aaggtgactt aaaaacgaaa gcgatgttaa gtaaagcttc ttcgggaaat       120
     aaaaaacttc atcgaccggc ttctaaacga cataaatcgg aagaccaaaa tattgatcta       180
     cataagttct caagtaagct tgaaagcatg tctgcaaagc acagtaaaga aaaatgtgcc       240
     aagaatatcc gcattgcctt acaagctgcg ggtgcagatg tatcaaagca tcctgtagct       300
     gcatctgact ggggccaaac gctagaaaag aatggttata agaaaatcaa gccggcattt       360
     aatcgtcctc aagaagggga tatttatatt atcgaacgta caagtgggca tacttacggg       420
     catattgcgg gctatacggg taatggctgg ttctctgatt tccgtcaaaa aacctatgcg       480
     gtctataaag aaaaagatgt gaaatatagt tactatcgcc tcgactctta a                531
//

If you have problems or comments...

PBIL Back to PBIL home page