(data stored in ACNUC29543 zone)

EMBL: CP000521.PE3

CP000521.PE3         Location/Qualifiers
FT   CDS_pept        2753..3835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0003"
FT                   /product="DNA replication recombination and repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10500"
FT                   /db_xref="GOA:A3M0Q6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M0Q6"
FT                   /protein_id="ABO10500.2"
FT                   /translation="MHLTRLNIERVRNLKTVALHGLQPFNVFYGANGSGKTSILEAIHL
FT                   LATGRSFRTHIPKNYIQYEADDAIVFAQSATEKIGMQKLASGEQLMKVNGDTVATQGQL
FT                   AKLLPLQHIDPQSTDIIDHGAKPRRQLLDWLMFHVEPEFYFAWQYYSRALKQRNTLLKT
FT                   RRNLSLADLEPWNKMLSDYGEILHSQRLSIVEQWNVYFQNDLSQLLPDLEIELEYSPGF
FT                   HTEQGLMQDLLNQHQKDIERRYTEYGPHRADLRLKTPFGHADDVLSRGQKKLLIIALKL
FT                   SQIAMLHASNKETVVLLDDLTAELDLTAQQRLIERLSQLGSQVFMTTLDHASVKKHLHD
FT                   LSISYQLFSVESGQVSLAAS"
     atgcatctta cgcgcttaaa tattgaacgt gtgcgtaatt taaaaacggt tgcactccat        60
     gggttgcaac cgtttaatgt cttttatggc gcaaacggtt cgggtaaaac atcaatttta       120
     gaagcgatcc atttgcttgc aacaggtcgc tcattccgta cacatatacc caaaaattat       180
     attcaatatg aagctgacga cgcgattgta tttgctcagt cagcaactga aaaaattggt       240
     atgcaaaaac tcgcttctgg tgagcaactc atgaaagtga atggcgatac cgttgcgact       300
     caaggtcagc tcgcaaagtt acttccttta cagcatattg atccacaaag tacggatatt       360
     attgatcacg gtgccaagcc aagaagacaa cttttagatt ggcttatgtt ccacgtggaa       420
     cctgaatttt attttgcgtg gcaatattac tctcgtgcgc taaagcagcg taatacctta       480
     ctcaaaacac ggcgtaatct ttccttagct gatttagaac cgtggaacaa aatgttgagt       540
     gattatggcg agattttgca ctcgcagcgt ttaagtattg tcgaacaatg gaatgtttat       600
     ttccaaaatg acttaagcca attactgcct gatttggaga ttgagctgga atatagccca       660
     ggttttcata cagagcaggg gcttatgcaa gacttgctga atcagcatca aaaagacatc       720
     gagagacgtt ataccgagta tggtccgcat cgggcagatt tgcgcttaaa aacgccattt       780
     ggacatgctg atgatgtttt atcaagaggt cagaaaaaac tcttgattat tgccttaaaa       840
     ctgtcacaaa ttgcaatgtt gcatgcgagt aataaggaaa ctgtggtatt attagatgat       900
     ctgacagcag aattagactt aaccgcacaa caacgtttaa ttgaacgatt aagccaactt       960
     ggtagccagg tttttatgac aactttagat catgcatcgg taaaaaaaca tttacatgat      1020
     ctgtctattt catatcaatt attcagtgtt gaatccggtc aagttagtct tgctgcatca      1080
     taa                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page