(data stored in ACNUC29543 zone)

EMBL: CP000521.PE302

CP000521.PE302       Location/Qualifiers
FT   CDS_pept        343717..345816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0317"
FT                   /product="putative fusaric acid resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10781"
FT                   /protein_id="ABO10781.2"
FT                   /translation="MLLKQILAFRPSKLDLIFAIKTFIAGMLALFVSFELDLINPMWSI
FT                   GTVLIIANPYSGMVSSKCVYRLLGTVGGAIIALTITPHLINTPWIFTVVLSLWVGFALY
FT                   VSLLDRTPRSYAFMLAGYSTAMIVYNAITYIDQYNIFDIALARVLEISIGVISSAVVSA
FT                   TILPMHIGSAIKQRVTKTLKDTENLFANLLNADQQQNNTQLLAAITRDTTDIHALAVHL
FT                   SYEKGELHGMTKPLQEMLHQMSMVVANLVALSERIKQLQELNFIESHSDKLKQLSGHVI
FT                   HFLEQKDQMTDENILQLPDEFENDFLNLNDSASEHQQVLLAAMKMDVRHFISNVLAVKV
FT                   LWQRIKQGNKEIPDNITPMTTTYPSLHRDHGVAVRGGISAVLITFIVTGVWILSGWKAG
FT                   FMMAQIGAVTACILTALDNPVPVLRIFIWGSVASAVLVFIYAFGIFPHVTTFWELGLVL
FT                   LPMFLFAVSMMANQALMPVGMVLGINTMMGLNLHNAYSMDAVSYLDSSFGMVMGVLVSL
FT                   VVIDVVRAMSPDTSANRILALHYRAMRQAIYIPYGIEFKVHLRGMLDRVGVLNTKMVQS
FT                   EEIKKSIQQALVESSAIIDLSRLQELANQVPTSSELAHHIGRLQQDLDELFRAKENEKG
FT                   ESDVLVQHIHQTLFELKQLASNIEDMTLRQRLFISLNNIAYSMCHVSSNQMNADRTLTG
FT                   ATAHG"
     atgttattaa agcaaatact ggctttccgc ccgagtaagc ttgatctaat ttttgcaata        60
     aagacattta ttgccggtat gttggcatta tttgtttcgt tcgaattaga cctgattaat       120
     ccaatgtggt cgatcggtac cgtcctgatt atcgccaatc cttattcggg tatggtgtcg       180
     tctaagtgtg tttatcgttt attgggaacg gtaggcgggg ctattattgc cttaaccatt       240
     actccgcatc tgattaatac gccgtggatc tttacggttg tgttatcact atgggtgggc       300
     tttgcgcttt atgtgtcttt attagaccgg actccccgca gttatgcatt tatgttggca       360
     ggttattcaa ccgcaatgat tgtgtataac gcgattactt atattgatca gtacaatatt       420
     tttgatattg ctttggcacg tgtacttgag atttcaattg gtgtgatttc gagtgcggtt       480
     gtgtctgcga ctattttgcc catgcatatt ggttcggcaa tcaaacagcg cgtaacgaaa       540
     accctcaaag atacagaaaa cctgtttgct aatttgttaa atgcagatca acagcaaaac       600
     aatacacagc ttttagctgc gattactcgt gatacgactg atattcatgc tctggcagtt       660
     cacttgagct atgaaaaagg tgagttgcat ggcatgacca aaccattgca agaaatgctc       720
     catcaaatgt cgatggtggt tgcgaacttg gttgctttat ctgaacgaat taaacaactg       780
     caagaactca attttattga aagtcattca gataaattaa agcagctttc agggcatgtg       840
     attcattttc tggaacaaaa agatcagatg actgatgaaa atattctgca gttacctgac       900
     gagtttgaaa atgatttctt gaacttaaat gattcggctt ctgaacatca gcaagtgtta       960
     ttggctgcca tgaaaatgga tgtgcgtcat ttcattagta atgttttagc tgtaaaagtt      1020
     ttatggcaac gcatcaagca aggtaataaa gagattccag ataacattac cccaatgact      1080
     acgacctatc caagtttaca ccgagatcat ggtgtggcag tcagaggtgg tattagtgca      1140
     gtgctgatta catttattgt gactggtgtg tggattcttt ctggctggaa agctgggttc      1200
     atgatggcac agatcggtgc agtcactgcc tgtatcttaa cggccctaga taaccctgtt      1260
     cctgtcttgc gtatttttat atggggcagt gtggcttcgg cggttttagt ttttatttac      1320
     gcgtttggta ttttccctca tgtcacaaca ttttgggaac ttggactcgt tttattacca      1380
     atgttcttat ttgcggtttc catgatggcg aatcaggcac tcatgccggt cgggatggtg      1440
     ctaggtatta ataccatgat ggggctgaac ttgcacaatg cttatagcat ggatgcagtg      1500
     tcttatttgg atagctcatt tggtatggtc atgggcgtat tggtgtcatt agtcgttatt      1560
     gatgttgtgc gtgccatgtc acccgatacc agtgcaaacc gtattttggc tttacattac      1620
     cgtgcgatgc gccaagccat atacattcct tatggtattg aatttaaagt tcacttacgg      1680
     gggatgttag accgtgttgg tgtcttaaat actaaaatgg ttcagtcaga agagattaaa      1740
     aaatctattc aacaggcttt ggttgaatca agtgcgatca ttgacttaag ccgactacaa      1800
     gagttagcaa atcaagttcc gacatcttca gaattggccc atcacattgg tcgtttgcaa      1860
     caagatttag atgagctatt tagagctaaa gaaaatgaaa aaggtgaaag tgatgtattg      1920
     gtacagcaca ttcaccaaac cttatttgaa cttaaacaac ttgcttcaaa tattgaagat      1980
     atgactctgc gtcaaagatt atttatttca ctaaataata ttgcttatag catgtgtcat      2040
     gtttcatcaa accaaatgaa tgcagatcgt acgcttacag gagccacagc gcatgggtga      2100
//

If you have problems or comments...

PBIL Back to PBIL home page