(data stored in ACNUC29543 zone)

EMBL: CP000521.PE304

CP000521.PE304       Location/Qualifiers
FT   CDS_pept        346055..347056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0318"
FT                   /product="Putative FusE-MFP/HlyD membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10782"
FT                   /protein_id="ABO10782.2"
FT                   /translation="MNQLELKKVIRPVILIVALMIAVYTIVHLWNYYNAAPWTRDGRVR
FT                   GDVIQVSSDVAGLVTEVLVQDNQTVKKGQVLFKIDVSRRALDVEQAKSDLAKAKAAYAQ
FT                   AQAGLAQAKANLIKSSTNIKLAEKNANRYSNLMDGAISKQEQDQVFATRDQSHAEHEQL
FT                   QAAIQQAEATIKQQQALVEAATSNLHLAELNMHRAAVVAPADGTLSNFDLRPGNYVQVG
FT                   QAVAALLDRKQLYVVGYFEETKLDRIHIGDEATVQLMGDRQKIKGHVQGIASGIEDRER
FT                   SSSSKLLANVNPTFSWVRLAQRVPVKIVLDEAPKNELAFVSGRTATVHIIEK"
     atgaatcaat tggagttgaa aaaagtcatc cgtccagtga ttttgattgt cgcattaatg        60
     attgctgtct ataccattgt gcatttatgg aactactata atgcagcacc gtggacacgt       120
     gatggtcgag ttcgtggtga cgttattcag gtctcttcag atgtagcagg ccttgtaacg       180
     gaagtattgg ttcaagataa ccagactgta aaaaaaggtc aggtgctttt taaaattgat       240
     gtctctcgcc gagctttaga tgtagaacaa gcaaaatctg atttggcaaa agcaaaagcg       300
     gcctatgctc aagcacaagc aggtctagcc caagccaaag caaacttgat taagtcgagt       360
     actaacatta agttagccga gaaaaacgca aaccgttatt caaacttaat ggatggtgcg       420
     atttctaagc aagaacaaga tcaggtcttt gcaactcgcg atcaatcaca cgcggaacat       480
     gagcaactcc aagctgctat tcaacaagct gaagccacta ttaaacagca acaggcattg       540
     gttgaagcag caacaagtaa tttacattta gcagaactca atatgcaccg tgcggctgtt       600
     gttgcaccgg cagatggaac attatctaac tttgatttgc gtccgggtaa ttatgttcaa       660
     gttggacaag cggttgcagc attgctagat cgtaagcagc tttatgttgt gggatatttt       720
     gaagaaacaa aattagaccg tattcatatt ggcgatgaag caactgtgca attaatgggt       780
     gatagacaga aaattaaagg ccatgtgcag ggtattgcat cgggtattga agaccgtgag       840
     cgttcaagta gttcgaaact gcttgcaaat gtaaacccga catttagctg ggttcgttta       900
     gcgcagcgtg tacctgtaaa aattgtatta gacgaagcac caaaaaatga gttggctttt       960
     gtgtctggcc gtactgctac agtacatatt attgaaaaat aa                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page