(data stored in ACNUC29543 zone)

EMBL: CP000521.PE305

CP000521.PE305       Location/Qualifiers
FT   CDS_pept        complement(347113..347553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10783"
FT                   /protein_id="ABO10783.2"
FT                   /translation="MTATQSKSIMAFDFGTQKMGMAIGQSAIESANPLPLFVMKDGIPN
FT                   WDQLLKIVKEWQPDLFIVGLPLNMDDSESELSTRARKFARRLRHQTNIETWMVDERLTT
FT                   REAREELGFYQEQGRAKKLSADSFAAALLIQSWYRNPVGLTP"
     atgaccgcaa cgcaatcaaa atcaattatg gcttttgact ttggcactca aaagatggga        60
     atggcgattg gtcagtctgc cattgaaagt gctaacccat taccactttt tgtgatgaaa       120
     gatggtattc ccaactggga ccaactttta aaaattgtga aagagtggca gcctgatttg       180
     tttattgttg gtcttccatt gaatatggat gatagcgagt cagaactttc aacacgggca       240
     cgtaagtttg cacgtcgctt acgccatcaa accaatattg aaacatggat ggtcgatgaa       300
     cgactcacca ctcgtgaggc aagagaagaa cttggttttt atcaagaaca aggtcgtgcc       360
     aagaagttgt cagccgatag ttttgccgcg gctttgctaa ttcagagctg gtatcgcaat       420
     cctgttggtt taacgccata a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page