(data stored in ACNUC29543 zone)

EMBL: CP000521.PE308

CP000521.PE308       Location/Qualifiers
FT   CDS_pept        350016..351326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10786"
FT                   /protein_id="ABO10786.2"
FT                   /translation="MKKTLSLPKAPIGMINRHKKTNPAEMNKILNQHFNAFKQAAAQGD
FT                   YVKAYQHVKKAVSLVPSHPGALSDLAYTELRLRRYDDAYQHYMQAIKASGSNVNTNLYD
FT                   GLTEVCHHLNKKEEKIKFGRLAISTKKELTKNEPTLNIPTHKPVPFSPNPQENIIVFSL
FT                   FGANPRYCETSILNTKLAQEIYPEWTCRFYVDESVPELVQQRLQANGAQVVHVSPTQKQ
FT                   LSGLFWRFLVMDDPVVKRFLVRDADSIVSYREKAAVDAWLKSDQWFHLMRDSYSHTELI
FT                   LAGMWGGCTGIFHNIEAHIRDYVATGRYPDNRVIDQHYLRYCIWPTLKQSVLVHDSQQF
FT                   DENSADFPVYDLTSMQNDQDNFHVGMDNGSPVVTTAVNHPTAEKVYWILFDENHDEVCR
FT                   YDAIVSKSRNIEVNLPHAFAKKIQLQQWKLQVYPYEN"
     atgaaaaaaa cattaagctt accgaaagca ccaataggga tgatcaaccg ccataaaaaa        60
     actaatcctg ctgaaatgaa taaaatttta aatcagcatt ttaatgcatt taaacaggct       120
     gctgcacagg gtgattatgt caaagcatat caacatgtaa aaaaagcagt aagtctggtt       180
     cctagccatc ccggagcatt gtctgattta gcttatactg agctacggtt acgccgttat       240
     gacgatgcat atcaacatta tatgcaagcc attaaagcaa gtggttctaa cgttaataca       300
     aatctatacg atggattgac cgaagtttgt catcatttaa ataaaaaaga agagaagatt       360
     aaatttgggc gtttagccat ttcaaccaaa aaagaactca caaagaatga gcctacttta       420
     aatataccca ctcataaacc cgtgcccttt agcccaaatc cacaagaaaa tattattgtt       480
     ttttctctat ttggagcaaa tccgcggtac tgtgaaactt ccattttaaa tactaagtta       540
     gctcaagaaa tctatcctga atggacgtgt cgattctatg tggatgagag cgttcccgaa       600
     cttgtacaac agaggttaca agcaaatggt gcacaagtcg tacatgtcag ccccactcaa       660
     aaacagttat caggtttatt ttggcgcttt ttagttatgg atgatccggt ggttaaacgg       720
     tttttagtac gtgatgccga ctctatcgtg tcttatcgtg agaaagccgc tgttgatgct       780
     tggcttaaga gtgatcaatg gttccattta atgagagata gctattctca tactgaatta       840
     attttggcgg gtatgtgggg cggttgcaca ggtatttttc ataatattga agcacatatc       900
     agggattatg ttgccactgg gaggtatccg gacaatcgag tcatagatca acattacctg       960
     cgttattgta tttggccgac tttaaaacaa agtgtgcttg tacatgatag ccagcaattt      1020
     gatgaaaata gtgccgattt tccggtttat gatctaactt caatgcaaaa tgaccaagac      1080
     aattttcatg tagggatgga taatggttca ccagtcgtta caactgcggt taatcatcca      1140
     acggcagaaa aagtttactg gattttattc gatgaaaatc acgatgaagt ttgcagatat      1200
     gatgcaattg tgtcgaagag tcgaaatatt gaagtgaatt taccccacgc ttttgctaaa      1260
     aaaattcagt tacagcagtg gaaattacaa gtctatccgt atgaaaactg a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page