(data stored in ACNUC29543 zone)

EMBL: CP000521.PE309

CP000521.PE309       Location/Qualifiers
FT   CDS_pept        351403..351729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10787"
FT                   /db_xref="GOA:A3M1J3"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1J3"
FT                   /protein_id="ABO10787.2"
FT                   /translation="MSSTQFDHVTVIKKSNVYFGGACISHTVQFEDGTKKTLGVILPTE
FT                   QPLTFETHVPERMEIISGECRVKIADSNESELFRAGQSFYVPGNSVFKIETDEVLDYVC
FT                   HLEG"
     atgagttcaa cccaatttga tcatgtaacg gtcatcaaaa aatcaaatgt ttattttggt        60
     ggagcatgta tcagccatac cgtgcaattt gaagatggaa cgaaaaaaac attaggtgtt       120
     attttgccga ctgaacagcc tttaacattt gaaacccatg ttcctgagcg tatggaaatt       180
     atttcaggtg aatgtcgcgt taaaattgca gacagcaatg aaagtgaatt gttccgcgct       240
     ggtcaatctt tttatgtacc aggcaatagt gttttcaaaa tcgagactga tgaagtgctt       300
     gattatgttt gccacttaga aggctaa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page