(data stored in ACNUC29543 zone)

EMBL: CP000521.PE311

CP000521.PE311       Location/Qualifiers
FT   CDS_pept        352616..353533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0325"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10789"
FT                   /protein_id="ABO10789.2"
FT                   /translation="MSPRTQGYFFVLVTMCIWGGFTLFARLNAQWHISAWDIAALRFAI
FT                   AFLILMPILIYKKDLAFLWSKHAVILALIGGVIYCLTVYTAFLYAPAAHAAIFLNGCIP
FT                   ICTAIAAYILFRQPFDKHTWVSLAIMITALALMSALMLQSSTSAFGIGDLLLFISAIWW
FT                   GIFTVLLKQWKLSAWHSMASVAIWSAIIYLPIYLLFLPKHFMDVDPLHLAVQSIFHGVF
FT                   VVIIATLTYVAAIQRLGAFKTGSIVTLAPFIAAILAVPLLGESLSPSIVVGLVGMGIGA
FT                   LQPWRWWFRQDSLTQKIKQQNTQN"
     atgtctcccc gtacgcaagg ttattttttt gtattggtga ccatgtgtat ttggggcggg        60
     tttacgcttt ttgcccgctt aaatgcacaa tggcacatca gtgcttggga tattgccgca       120
     ctacgctttg ctatagcctt cctaattttg atgcctatct taatttataa aaaagatctc       180
     gcttttttat ggagtaaaca tgcggttatt ttggcattga ttggtggagt catttactgc       240
     cttacggttt atacagcttt tctttatgca ccagctgcac atgctgcaat atttttaaat       300
     ggctgtattc ctatctgtac cgctatagct gcttatattt tatttagaca gccatttgat       360
     aaacatacat gggtgagtct ggcaattatg attactgcct tggccctcat gagcgcattg       420
     atgttacaaa gtagtacctc tgcttttgga attggagatt tacttctgtt tatcagtgcg       480
     atttggtggg ggatttttac tgtactactt aaacagtgga agctctctgc ttggcattct       540
     atggcaagcg tcgcaatctg gtctgcaatt atttatttgc cgatttatct gttgttctta       600
     cctaagcact ttatggatgt agatcctttg cacttagctg tacaaagtat tttccatggc       660
     gtgtttgtcg ttattattgc gacattaacc tatgttgctg ctattcagcg tcttggcgca       720
     tttaaaacgg gaagtattgt aactttggca ccgtttattg ctgctatttt agctgtacct       780
     ttacttggtg aatcattaag cccatcaatt gtagtgggct tagtaggtat gggaataggc       840
     gctttacagc cttggcgctg gtggtttaga caagatagcc tgacacaaaa gattaagcag       900
     caaaatacac aaaattag                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page