(data stored in ACNUC29543 zone)

EMBL: CP000521.PE314

CP000521.PE314       Location/Qualifiers
FT   CDS_pept        complement(354988..356214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0328"
FT                   /product="type 4 fimbrial assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10792"
FT                   /protein_id="ABO10792.2"
FT                   /translation="MAVKKAQMMPTFAYEGVDRKGVKIKGELPAKNMALAKVTLRKQGV
FT                   TVRNIREKRKNILEGLFKKKVTTLDITIFTRQLATMMKAGVPLVQGFEIVAEGLENPAM
FT                   REVVLGIKGEVEGGSTFASALRKYPQHFDNLFCSLVESGEQSGALETMLDRVAIYKEKS
FT                   ELLKQKIKKAMKYPATVIVVAIVVTIILMVKVVPVFQDLFASFGADLPAFTQMVVNMSK
FT                   WMQEYWFIMIIAIGAVIAAFLEAKKRSKKFRDGLDKLALKLPIFGDLVYKAIIARYSRT
FT                   LATTFAAGVPLIDALESTAGATNNVIYEKAVMKIREDVATGQQLQFAMRVSNRFPSMAI
FT                   QMVAIGEESGALDSMLDKVATYYENEVDNAVDGLTSMMEPLIMAILGVLVGGLVIAMYL
FT                   PIFQMGSVV"
     atggctgtca aaaaggcaca aatgatgccg acttttgctt atgaaggggt tgaccgtaag        60
     ggcgtaaaaa tcaagggaga acttccggct aaaaacatgg ccttagccaa agtaacctta       120
     cgcaaacaag gggtgactgt tcgaaatata cgtgaaaaac gtaaaaatat tcttgaaggt       180
     ttattcaaga aaaaagtcac cacactcgat attacgattt ttactcgaca attggcgacc       240
     atgatgaaag ctggtgtacc actcgtacaa ggctttgaaa ttgtagctga aggtttagaa       300
     aacccggcca tgcgtgaggt tgtactcggt attaaaggtg aagtcgaagg tggtagtact       360
     tttgcctcag ctttaagaaa atatcctcaa cattttgata acttgttttg ttcacttgtt       420
     gagtctggtg aacaatcagg cgcactcgaa acgatgctgg accgcgttgc aatttacaaa       480
     gaaaaaagtg agttgctcaa gcaaaaaatc aagaaagcaa tgaaataccc agcaacagtt       540
     attgtagtag ccattgtggt gaccattatt ttgatggtta aagtagttcc cgttttccaa       600
     gatttatttg cgtcttttgg agcagattta cctgcattta cgcaaatggt tgtgaatatg       660
     tcgaaatgga tgcaggaata ctggtttatt atgattattg cgattggcgc agtcattgct       720
     gcctttctgg aagcaaaaaa acgcagtaaa aagtttcgtg atggcttaga taaactggcg       780
     cttaagttac ctatttttgg ggacttggtt tataaagcaa ttattgcccg ctatagccgc       840
     acgcttgcta caacatttgc cgcaggtgtt ccacttattg atgcattaga atcgactgct       900
     ggcgcaacca ataacgtgat ttatgaaaaa gctgtgatga aaattcgtga agatgtcgca       960
     acgggtcaac agcttcagtt tgctatgcgg gtctctaatc gttttccatc tatggctata      1020
     caaatggttg caattggtga agaatcgggt gcactagaca gcatgctcga taaagttgcc      1080
     acttattatg aaaatgaagt ggataatgcc gttgatggtt taacctctat gatggaacct      1140
     ttaattatgg caattttagg ggtgctcgta ggcggtctgg taattgctat gtatcttcca      1200
     attttccaaa tgggctcagt tgtataa                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page