(data stored in ACNUC29543 zone)

EMBL: CP000521.PE318

CP000521.PE318       Location/Qualifiers
FT   CDS_pept        359859..360383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10796"
FT                   /db_xref="GOA:A3M1K2"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1K2"
FT                   /protein_id="ABO10796.2"
FT                   /translation="MKLSNKSQALYDMIAPAVEACGVDLWGIEFLPQGKRSLLRIYIDR
FT                   PVDENAEPVINEDGEVEQGRGIGVEDCVRVTQQVGAMLDVHDPISGEYALEVSSPGWDR
FT                   PFFQLEQLQGYIGQQVALRLIAAVENRRKFQAKLLAVDLENEEIQVEVEGKHVLDIDSN
FT                   NIDKANLIYQD"
     atgaaattat caaataaatc ccaagcattg tatgacatga ttgctccagc agtggaggca        60
     tgtggtgtcg acctttgggg aattgaattc cttccacaag gtaagcgttc attattgcgt       120
     atttatatcg atagaccggt tgatgaaaat gctgaaccag tgattaatga agatggtgaa       180
     gtagagcaag gccgcggtat tggtgtagaa gattgtgttc gtgttacaca acaggtcggc       240
     gcaatgctgg atgtccatga tccgatttca ggtgaatatg cattagaagt ttcttcacca       300
     ggttgggatc gcccattttt tcaactcgaa cagttgcaag gctacattgg acaacaggtt       360
     gctttgcgtt tgattgctgc agtagaaaat cgtcgtaaat ttcaagcaaa actccttgct       420
     gtagaccttg aaaatgaaga gattcaggtt gaagttgaag gaaagcatgt gcttgatatc       480
     gacagcaaca atatcgataa agcaaacttg atctatcaag attaa                       525
//

If you have problems or comments...

PBIL Back to PBIL home page