(data stored in ACNUC29543 zone)

EMBL: CP000521.PE32

CP000521.PE32        Location/Qualifiers
FT   CDS_pept        complement(40146..40466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0032"
FT                   /product="putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10527"
FT                   /protein_id="ABO10527.2"
FT                   /translation="MKKITTAIILSMSGLIATTAMAAPHDHYHHQGYETKTVKVIHKDD
FT                   HANIWRAGQVVPHQYQHPRYVIDYRSHQKLTKPGRYQKWYKVNGNYVLVNEQSHKIIKV
FT                   IR"
     atgaaaaaga taacaacagc aattattctt tcaatgagtg gtttaatcgc aacaacagca        60
     atggctgcgc ctcacgacca ttatcaccac caaggatatg agacaaaaac agtcaaagtt       120
     atccataaag atgatcatgc gaatatttgg cgtgcaggcc aagttgtacc gcatcaatac       180
     caacatccac gttatgtcat tgactaccgc tcacaccaga aattgactaa gccaggtcgt       240
     tatcaaaaat ggtataaggt gaacggaaat tatgtactcg taaatgagca aagccataaa       300
     attattaaag taattcgtta a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page