(data stored in ACNUC29543 zone)

EMBL: CP000521.PE322

CP000521.PE322       Location/Qualifiers
FT   CDS_pept        complement(365761..366288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0340"
FT                   /product="pH adaptation potassium efflux system E
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10800"
FT                   /protein_id="ABO10800.2"
FT                   /translation="MQLSKLLDRWFPHPFVSFLIIIFWLMLAHSLDASDLLMAVVLGLV
FT                   IPRLVRPFITRTPHIHWKPAIKLCFVVLWDIIVSNFRVAKLVLGSPKKLHPKWYRVPLE
FT                   TEHEQVNSLLAMIITTTPGTVSAGIDQERGDILVHSLSTENTESDVQDIKQRYEAPLME
FT                   IFDVKSKSEDNA"
     atgcagctat ctaaattgct tgaccgctgg tttccgcatc catttgtttc ttttttgatt        60
     atcatcttct ggttaatgct cgcgcatagt cttgatgcga gcgacctgct tatggctgta       120
     gttttggggc ttgttattcc tcgtctagtt cgtcctttta ttaccagaac cccgcatatc       180
     cattggaaac ctgccataaa actgtgtttt gttgtcttgt gggatattat tgtttccaat       240
     tttcgggttg ctaaactggt attagggtca ccgaaaaaat tacatcctaa atggtaccgt       300
     gttccattag aaacagaaca tgaacaagta aactctttac tggcaatgat tattaccaca       360
     acgcctggca cggtctctgc cggtattgat caagagcgcg gtgatatttt ggtccactct       420
     cttagtacag aaaatactga aagtgatgtg caagacatca aacaacgcta tgaggctcca       480
     ctcatggaaa tttttgatgt gaaaagcaaa tcggaggaca acgcatga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page