(data stored in ACNUC29543 zone)

EMBL: CP000521.PE324

CP000521.PE324       Location/Qualifiers
FT   CDS_pept        complement(368102..368470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0342"
FT                   /product="pH adaptation potassium efflux system C
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10802"
FT                   /protein_id="ABO10802.2"
FT                   /translation="MISLEFLLASAIGLLVATGIYLILRARTFPVVLGLAVLGYAVNLF
FT                   LFAMGRLQVSSPAILTETTNITDPLPQALVLTAIVIGFATTAFIVQLALRSRYESGSDH
FT                   VDAKEDISPTYDPREDEP"
     atgatcagtt tagaattctt actggcctct gccattgggc tacttgttgc gacaggcatt        60
     tatctaattt tacgtgcgcg taccttccct gttgtgttgg gcttagcagt gctgggctat       120
     gcggttaact tatttttgtt tgcgatgggt cgattgcaag tcagctcacc agccatccta       180
     accgaaacca ccaatattac agatccactt ccacaagcac ttgttttaac agcaatcgtg       240
     atcggttttg ccactaccgc ttttattgtg cagctcgcat tacgtagccg ttatgaatcc       300
     ggtagtgacc atgttgatgc caaagaagat atttctccaa catacgaccc acgtgaggat       360
     gagccgtga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page