(data stored in ACNUC29543 zone)

EMBL: CP000521.PE325

CP000521.PE325       Location/Qualifiers
FT   CDS_pept        complement(368467..371316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0343"
FT                   /product="pH adaptation potassium efflux system
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10803"
FT                   /protein_id="ABO10803.2"
FT                   /translation="MDTSVLPIIILLPLILGTTLVSLLQRFSRGVTALGAIGVSLTSFG
FT                   LLLTQAKTVLGGASIQQSWDWLPQLGINLSFRLDALGLLFSLLITGIGTLIYIYAYYYL
FT                   GPKNSLSKLYLLLMLFMAAMLGISLSNNLIILLVFWELTSISSFLLVGYWSHYEAAQRG
FT                   SRMALTITGMGGLAMLGGFVLLGQITGTYEINDIVGMKDLIQSHYLFVPTLLLILLGTF
FT                   TKSAQFPFHFWLPNAMAAPTPVSAYLHSATMVKAGIFLLARLAPIFIGAALYHNIVTFV
FT                   GLFTLCMAACFAIFKEDLKGLLAYSTISHLGLIVCLLGIGSPLAVAAAIFHIINHATFK
FT                   AALFMIAGIIDHETGTRDLRKLSGIWQLLPFTATLTMITAASMAGVPLTNGFISKEMFF
FT                   TELLASLSGSTVIFASIIATLAGIFAVSYSIRLVHGVFFDGPVGKQVPNKNAHEPPIGM
FT                   RAPAILLATLCILVGIFPALLVEPLVNSVTRASLMQPDFAGTHLAIWHGFNAPLIMSII
FT                   ALVGGTLFYFALAKDGMIRKIDLDPRLGRLQGRILFDLFLKHLLLTSRKIKQKTENGSL
FT                   QSYLFLIIAFSIVMVTLPLFNQGLTTGTRELTHAPWIAVVLWLTLFSGCWMMLWFHHER
FT                   IKAVLISGAIGLVVTMVFVTMSAPDLALTQITVDVVTTVLLLMSLSLLPQLTPYESRRS
FT                   RRWRDAALAIIGGLGIGWITWLILTRDHNSISWFFAQQSLPLGGGSNIVNVILVDFRGF
FT                   DTFGEITVLGIAAIGALCLMDGMRVHGTTMTQGLTYRFNPSPLMFRITASWVLPLALVV
FT                   SVYIFMRGHNYPGGGFIAGLITSMALIIQYIALGQDQAEQMLKAQSGRLYEIWIGSGLT
FT                   IAGLTGIAAWFWARPFLTSAHVYVELPVLGKLHLASAASFDLGVYITVVGATMLLISVL
FT                   GDSRHSSMSGPVPHGEKSS"
     atggatacga gtgtgctacc gataattatc ttattaccgt taatattagg caccaccctt        60
     gtttcattgc ttcaacggtt ttcacgtgga gtaacggctt taggggcgat cggagtcagt       120
     ttaaccagtt ttggtttatt actgactcag gctaaaactg tgcttggtgg tgcaagcatt       180
     caacaaagtt gggattggtt accacaatta ggaattaatc tgagctttag acttgatgcc       240
     cttggtttat tattttctct tcttattacc ggtatcggta cactcattta tatttatgcc       300
     tattattatc taggccctaa aaattcatta agtaaattat atttattact catgctgttt       360
     atggcagcaa tgcttggtat ttctctttct aacaatttaa ttattttatt agtcttttgg       420
     gaacttacca gtatttcatc cttcctatta gtcggttact ggagtcatta cgaagctgct       480
     caacgtggct cgcgtatggc acttaccatt acaggtatgg gtggactcgc catgctaggt       540
     ggatttgtct tattaggaca aatcacagga acctacgaaa ttaatgatat tgtcggaatg       600
     aaagacctca ttcaaagtca ctatctgttt gttccgacgc ttttgcttat tttactgggt       660
     acatttacta aaagtgctca gttcccgttc catttttggt tacccaatgc aatggcagcg       720
     cccactcccg tgtcggccta tttgcactct gccaccatgg taaaagctgg gattttctta       780
     ttagctcgtc ttgcacctat ttttattggc gctgcgcttt atcacaatat tgtcacgttt       840
     gtcggcctat ttacactttg tatggccgca tgcttcgcaa tttttaaaga agatctaaaa       900
     ggactgctag cctattctac aattagtcat ttaggtctta tcgtttgcct gcttggtatt       960
     ggttcacctt tagctgttgc tgcggcaatt ttccatatta ttaaccacgc aacctttaaa      1020
     gctgccctgt ttatgattgc cgggatcatt gaccatgaaa caggtacacg tgaccttaga      1080
     aagttaagtg ggatttggca actattaccg tttaccgcaa cactgactat gattacagcg      1140
     gcatcaatgg caggtgttcc tctcactaat ggctttattt ctaaggaaat gttctttacc      1200
     gagctattag cgagcctttc aggatcaact gttatctttg ccagtattat tgcgacgctt      1260
     gctggtattt ttgcagtcag ctattcaatt cgcttagtac acggcgtatt ttttgatggc      1320
     cccgtaggga aacaagttcc aaataaaaat gcccatgagc cacctatcgg catgcgagca      1380
     ccagctatat tgcttgcgac attatgtatt ttggtcggta ttttccccgc tctactggtc      1440
     gagcctctag ttaacagtgt gacacgtgca agtcttatgc aacctgattt tgcaggtact      1500
     catcttgcaa tttggcatgg atttaatgcg ccattaatca tgagtattat tgctctggtt      1560
     ggcggtacgc ttttctattt tgccctagca aaagatggca tgattcgtaa gatcgacctt      1620
     gacccacgtt tagggcgctt acaaggccgt attttatttg acttattctt aaagcattta      1680
     ttattaacaa gccgaaaaat taaacaaaaa accgaaaatg gttctttgca aagttacctg      1740
     ttcttaatca ttgcttttag catcgtcatg gttactctgc ctttgttcaa tcagggcctt      1800
     accacaggta cacgtgagct gactcacgca ccatggattg cagtagttct ttggctgacc      1860
     ttattctcag gttgctggat gatgctttgg ttccaccacg aacgtatcaa ggctgtactc      1920
     attagcggtg caattggtct tgtggttacc atggtatttg tcaccatgtc ggcacctgac      1980
     ttagcactca ctcaaattac ggtagatgta gttacgactg ttctgttgtt gatgagctta      2040
     tcgttactcc cacaacttac accatatgaa tctcgtcgct caagacgttg gagagatgct      2100
     gcgttagcaa ttattggcgg tttaggaatt ggttggatta catggcttat tttaacgcgt      2160
     gatcataatt cgatttcatg gttctttgct cagcaatcct taccacttgg cggcggttca      2220
     aacattgtaa atgttatttt ggtggacttc cgtggctttg atacctttgg tgaaattaca      2280
     gtactaggta ttgctgcgat tggtgcgcta tgtctcatgg atggcatgcg cgtacatggc      2340
     accaccatga cacaaggcct cacctaccgc tttaacccat ctccgcttat gttccgtatt      2400
     acggcctctt gggtgttacc tttagcattg gtcgtaagtg tctatatctt tatgcgtggg      2460
     cacaactacc cgggtggtgg ctttattgca ggtctaatta cctcaatggc actgattatt      2520
     cagtatattg ctttaggtca agatcaagca gaacaaatgt taaaagccca atccggtcgt      2580
     ctttacgaaa tctggattgg ctccggatta acaattgcag gccttactgg cattgccgca      2640
     tggttttggg cacgtccatt cttaaccagt gcgcacgtct atgttgaatt accagtttta      2700
     ggtaagttac atctggcttc agcagcgagc tttgatctgg gtgtgtatat caccgtagta      2760
     ggcgctacca tgctactcat ttctgtatta ggggactctc gccactcgag tatgtctggt      2820
     cctgtacctc atggggagaa atcatcatga                                       2850
//

If you have problems or comments...

PBIL Back to PBIL home page