(data stored in ACNUC29543 zone)

EMBL: CP000521.PE326

CP000521.PE326       Location/Qualifiers
FT   CDS_pept        complement(371631..373013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0344"
FT                   /product="putative ATP binding site"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10804"
FT                   /protein_id="ABO10804.2"
FT                   /translation="MKLESIQFKHIALFHDLKIQFQYDKQPITLILGEQATGKSMLLKH
FT                   IYHALTWFPARLKDARTPGIVMPDQDISHSRLQSKIEVSIQIPPEFGQLPETTSTQQTE
FT                   TSLCSWKLFKTLNSSGVGISQVETQQLDQTITLYHQVTRKDPLQGLPLLAYYPSERFVN
FT                   DINLLNKNLPGITQSISAYDISFIPFTTFARFFEWLREISDIENAQAAHVVQRIISKQS
FT                   NSQDQEEILRQLQLELAGHPKQLPSPNLYALKSALKIIFPELEDFYLQYHPKLQLMAHY
FT                   KGEVLAFQQLSNTTKTWIALVGDVVRRLCLLNPLSLDPCLEGEGVLLIDQIDSQLDSAH
FT                   CSEILNRLHRAFPRLQIIVTGSREELLEHAAAYQCFKLEHGKISPLDLNTTQQQLEHLY
FT                   TLLQRDEALTPHIDPLPLDTEPATAQIDSLYQQIQNLNEQQKNELLRMIHAGDTSEETS
FT                   SL"
     atgaaacttg aatctatcca atttaaacac attgctctgt ttcatgacct aaaaatacag        60
     tttcaatatg acaaacaacc gattacttta attttaggcg agcaagcaac tggcaaaagt       120
     atgctactca agcatattta tcatgcttta acgtggtttc ctgcgcgcct taaagatgca       180
     cgcaccccag gcattgtcat gcctgatcag gacattagcc attctcgttt gcaatctaaa       240
     atagaagtca gcatccagat tccaccggaa tttggacagc tccctgaaac cacttcaacc       300
     cagcaaaccg aaacatctct ttgtagctgg aaactgttca agaccttaaa ttcaagtggt       360
     gtagggatta gtcaagtcga aacccagcag ctcgatcaaa ccattaccct ttatcatcaa       420
     gtcacaagaa aagacccact tcaaggcctt cccttactcg cttattatcc gtcagagcga       480
     tttgttaacg atataaattt actgaataaa aatttaccgg gtattactca gtctatttct       540
     gcttatgaca ttagcttcat tccgtttacc accttcgccc gcttttttga gtggttacgt       600
     gaaattagcg atattgaaaa tgcgcaagcg gctcatgttg tgcagcgaat tatttcgaaa       660
     caatccaatt cacaagatca ggaagaaatt ttacgtcagc tacaacttga attggcagga       720
     caccctaaac agcttccttc acctaatttg tacgcattaa aatcggcgtt aaagattatt       780
     tttcctgagc ttgaagactt ttatttgcaa tatcacccaa aacttcaact tatggcacat       840
     tacaagggtg aagtcttggc ctttcaacaa ctttccaata ccactaaaac atggattgca       900
     ctcgtaggcg atgtggttcg caggctttgt ttgctcaatc cgttgagctt agacccttgt       960
     cttgaaggtg aaggagtttt gttaattgac cagatcgatt cacaactaga ttcagcacat      1020
     tgctcagaaa ttttaaatcg tcttcatcgc gcattcccac gcttacaaat tattgtgacc      1080
     ggaagccgtg aagaattgct tgaacatgca gccgcatatc aatgttttaa attagagcat      1140
     ggaaaaatca gtccacttga tttaaatacc actcagcagc aactcgaaca tctttatacg      1200
     ttattacaac gagatgaagc gttaacgccg catatagatc ccctaccgct tgataccgag      1260
     ccggcaacag ctcaaattga tagtttgtac caacaaatcc aaaatctaaa tgaacagcaa      1320
     aaaaatgaat tattacgtat gattcatgca ggagacacct cggaagaaac ctcctctctt      1380
     taa                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page