(data stored in ACNUC29543 zone)

EMBL: CP000521.PE33

CP000521.PE33        Location/Qualifiers
FT   CDS_pept        complement(40689..41099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0033"
FT                   /product="putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10528"
FT                   /protein_id="ABO10528.2"
FT                   /translation="MKKLFTILALCITVLTTSMASFADPPFDRGHGPKGPKGGPRGEWN
FT                   DRGHKFDRDDNGDRVRDERRMREERGFERLKQHRWQPGYVMPQHYRGNGYKVDYKDNNL
FT                   PKPDRNQQWYKINNDYILVDTDSNSIVSIRGF"
     atgaaaaagt tgttcaccat cttagccctt tgcatcactg tactgaccac cagtatggca        60
     agctttgctg atcctccttt tgaccgagga catggcccga aaggtcctaa aggcggacct       120
     cgtggtgaat ggaatgatcg tgggcataaa tttgaccgtg acgataatgg tgatcgtgtt       180
     cgcgatgaac gccgtatgcg tgaggaacgt ggctttgagc gtctgaaaca acatcgttgg       240
     cagccaggtt atgtgatgcc acagcactat cgtggtaatg gttataaagt cgactataaa       300
     gacaataact tacctaaacc cgatcgtaac cagcagtggt acaaaattaa caatgactat       360
     attttagtcg acacggactc taacagtatt gtgagtattc gcggtttcta a                411
//

If you have problems or comments...

PBIL Back to PBIL home page