(data stored in ACNUC29543 zone)

EMBL: CP000521.PE331

CP000521.PE331       Location/Qualifiers
FT   CDS_pept        complement(378546..379214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10809"
FT                   /protein_id="ABO10809.2"
FT                   /translation="MWSILALGAVERIIHHLIDLDALTRIQLNQLQGKMLRVIIDSPQL
FT                   SVDVFFDQEKVRLEPTVTGHSEKPSIFEQRPFDPQFKISEATATLHVKDVVELIKLLLS
FT                   DPDQIGNIPLQGDYHLLQDIQKIMQQAEPDLAAHLSKWVGPQLAHEIGKIQLAPKHLKR
FT                   SLQSHLFFAEDALKEDSGLFAPRWEMDDLNQATRKLNQDIDRLEAKLQQLNAQLQPTQD
FT                   "
     atgtggtcga ttctggcact cggtgcagtc gaacgtatca ttcatcatct gatcgatctg        60
     gatgcattaa cccgcattca gctcaatcag ctacagggca aaatgttgcg tgttatcatc       120
     gatagcccgc aactttctgt tgatgtattc tttgaccaag aaaaagtacg tcttgaacct       180
     accgttacag ggcacagtga aaagccatct atttttgagc agcgcccttt tgatccacaa       240
     tttaaaattt ctgaagccac tgcaactttg catgtcaaag atgtcgttga actgatcaaa       300
     ttattattaa gcgatccaga ccaaattggt aatatcccgc ttcaaggtga ttatcacctc       360
     ttacaggata ttcaaaaaat tatgcagcaa gctgaacctg atttagctgc gcatctatca       420
     aaatgggttg gtcctcaact cgctcacgaa atcggtaaga tccaacttgc accaaaacat       480
     ttaaaacgct ctcttcaaag tcatctattt tttgctgaag atgccttaaa agaagacagt       540
     ggtttatttg ccccacgttg ggaaatggac gatttaaatc aggctacgcg taagcttaat       600
     caagacattg atcgtctaga agctaaattg cagcagctca atgcacaact acaacccact       660
     caagactag                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page