(data stored in ACNUC29543 zone)

EMBL: CP000521.PE333

CP000521.PE333       Location/Qualifiers
FT   CDS_pept        complement(380322..381029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10811"
FT                   /protein_id="ABO10811.2"
FT                   /translation="MSKLAAFDELLQQYKTFNYHDNPVLAQRLQDVQTWLKERMKETHH
FT                   DFFNLPEHKLMAQYFLNRLYGGPEFDALAAQIERLLKYAHKAEKVLPENAIKTGTKSVS
FT                   LAVLATQLDEQVAMQLLEDYPADTVLTDEIMRLTLIKLDQAEARYQQLALLDDLGAALD
FT                   KYMRSFMMFTAFKMCKGIAQKYHFELMYDFIQDGFSAMKPLKSAEAFIKTFTEKERQIV
FT                   EKVHSGHPNPFRV"
     atgtctaaac tcgctgcttt tgatgaactt ttacaacaat ataaaacatt taattatcac        60
     gacaatccag tgctagccca acgtttgcaa gatgtacaaa catggctaaa agaacggatg       120
     aaagagacgc atcacgactt ttttaatttg ccagaacaca aactgatggc tcagtacttt       180
     ttaaaccgtt tatatggtgg accagagttc gatgcacttg cagcacaaat tgaacgttta       240
     ttgaaatatg cacataaagc agaaaaggtt ttacctgaaa acgcaattaa gacaggtaca       300
     aagtcggtaa gtttggctgt acttgctact caacttgatg aacaagtagc aatgcagctt       360
     cttgaagact atccggcaga taccgtactt accgacgaga tcatgcgctt aaccttaatc       420
     aagcttgatc aggccgaagc ccgttaccag cagcttgccc ttcttgacga tttaggagca       480
     gcactcgata aatatatgcg ttcatttatg atgtttactg cttttaaaat gtgtaaaggt       540
     attgcacaaa aatatcactt cgaattgatg tatgatttta ttcaagatgg ttttagcgca       600
     atgaaacctt taaaatcggc tgaggccttt attaaaactt ttacggaaaa agaacgccag       660
     attgttgaaa aagtacattc aggacatccg aatccgttta gagtgtga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page