(data stored in ACNUC29543 zone)

EMBL: CP000521.PE34

CP000521.PE34        Location/Qualifiers
FT   CDS_pept        complement(41317..42063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0034"
FT                   /product="putative oxoacyl-(acyl carrier protein)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10529"
FT                   /protein_id="ABO10529.2"
FT                   /translation="MKYSEYQPRPDLLKDRIILITGAGDGIGRAAALSYALHGATVVLH
FT                   GRTLNKLEVIYDEIEGLGAPQPAILPLQLSSASDRDYDFLVSTLEKQFGRLDGILHNAG
FT                   ILGERVELAHYPAEVWDDVMAVNLRAPFALTQALLPLLQKSENASVVFTSSGVGREARA
FT                   LWGAYSVSKVAIEAVSKIFAAEHTYPNIRFNCINPGATRTAMRAKAYPEEDPKTLPTPE
FT                   SIMPAYLYLMGEDSLTLNGQSIDAQD"
     atgaaatatt cagaatatca acctcgtccg gatctactca aagatcgaat tattttaatc        60
     actggtgctg gtgatggaat tgggcgagct gcggccctca gttatgcttt acatggtgca       120
     actgtagtct tgcatggtag aaccttaaat aaacttgaag taatttatga tgaaattgaa       180
     ggattaggcg cacctcagcc tgctatttta cccctccagc tttcgagtgc ttccgatcgc       240
     gattatgatt tcttagtaag tacgctagaa aaacaatttg gtcgtctgga tggcattttg       300
     cataatgcag gtattttggg tgagcgagta gaacttgcac attatccagc agaagtatgg       360
     gatgatgtga tggccgtcaa tttacgtgca ccttttgctt taacccaagc tttattaccg       420
     ctattacaaa agtcagaaaa cgcttctgtt gtatttacca gctcaggtgt aggccgtgag       480
     gcacgcgcgc tctggggggc atattctgtc tcgaaagtcg cgatagaagc ggtgagcaag       540
     atttttgcag ctgagcatac ttatccaaat attcgcttta attgtattaa cccaggagct       600
     acacgtactg ccatgcgtgc taaagcttat cctgaagaag atccgaaaac attaccaaca       660
     cctgagtcca tcatgccggc ttatctttat ttaatgggtg aagatagctt aacgctcaat       720
     ggacaaagta ttgatgcaca ggattaa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page