(data stored in ACNUC29543 zone)

EMBL: CP000521.PE340

CP000521.PE340       Location/Qualifiers
FT   CDS_pept        390789..392552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0358"
FT                   /product="exonuclease V alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10818"
FT                   /protein_id="ABO10818.2"
FT                   /translation="MDKCVDNLNSPEQSDLSWLMTWSTFLNQAPFTAQTQAPEAAYFLQ
FT                   QLIEASLQGDSCIEISPEQIETLGQLVISAEQAKSQVAPCVHDGQGLALYRYWNLEQRL
FT                   AEQIRRLKQQPIQPVSCEEHLDLLTDPHQRAALQMVTRQSLSIITGGPGTGKTYTLARI
FT                   IAVLSQAIPHIRVAMAAPTGKAAQRMQEALQNSFNDPKLLESGLMSDELRNQSTQTIHR
FT                   LLGMGHSQTPRFNQKQPLPYDVIVVDEASMLDLNLATLLFEAVPESCRIILLGDANQLA
FT                   SVDVGAVLADLQQIEALSENRVHLQTSRRFAEGALIGQVARFIQMQTGQIDHEQVLQQF
FT                   EIDIVQVSELRSIPLEADMPDVVQLEYLPEESPIALETYYQKLMVGFQGYVQSLKAYLQ
FT                   DDRSTEHIENIVKSFDDYRILTAVRHGPFGLQQLNQYAERWLQQQLGIVTLGGWYVGRP
FT                   VMMTYNDYQLGISNGDIGLCFEHRTQPQQFEVYFPSLNKWVAANRLPKSIQSAFALTIH
FT                   KSQGSEFTHTAVVLDQAAKNLLSQELIYTAITRAKKVVSLLVDPEALLQSFTVRTTRKS
FT                   GLVEKVNRLVR"
     gtggataagt gtgtggacaa tctaaatagc cctgaacaaa gcgatttaag ctggttaatg        60
     acttggagta cctttctaaa tcaagccccg tttactgcac agacacaagc tccagaggca       120
     gcttattttt tgcagcagct aattgaagcg agcttgcagg gtgacagttg tattgagatt       180
     agcccagagc aaatagaaac acttggccaa ctggtgatat ctgctgaaca agcaaagtct       240
     caagttgccc cttgtgtcca cgacgggcag gggttggcat tataccgata ttggaaccta       300
     gagcaacgtc tagctgagca aattcgccga ttaaagcaac aaccaattca acctgtttca       360
     tgtgaagagc atttagactt attaactgat cctcatcagc gagctgcttt gcaaatggtg       420
     actcggcaga gcttaagtat tattacaggt gggccgggta caggtaagac ctatacgctt       480
     gctcgtatta ttgctgtgct tagtcaggca attccgcata tccgtgtggc gatggctgct       540
     ccgacgggta aagctgcaca gcgtatgcaa gaagccttac aaaactcgtt taatgatccc       600
     aaactgcttg agtcggggct aatgagtgat gagctaagaa atcaaagtac ccaaactatc       660
     catcgattat taggtatggg gcatagtcaa actccacggt ttaatcaaaa acagcctttg       720
     ccttatgacg ttattgtggt ggatgaagcc tctatgctgg acttaaatct ggcaacgtta       780
     ttatttgaag cggtccctga gtcttgccga attattttat taggtgatgc caaccagctt       840
     gcttctgtag acgtcggagc tgtacttgca gatttacagc aaatcgaggc tttgtctgaa       900
     aaccgtgttc accttcaaac cagccgtcgt tttgcggaag gggctttgat tggtcaggta       960
     gcccgattta ttcaaatgca aactggtcaa attgaccatg agcaagtttt acaacaattt      1020
     gaaatcgata ttgttcaggt ttcagagcta cgttcaattc ctttagaagc tgatatgccc      1080
     gatgtggttc agcttgaata tttacccgaa gagtccccta tagcgctaga aacttactac      1140
     caaaaattga tggtgggttt tcaaggctat gtgcaaagct taaaagctta tttacaagat      1200
     gatcgttcaa ctgaacatat tgaaaatatc gttaagtcat tcgatgacta ccgtatttta      1260
     actgccgtac gtcatggacc atttggtttg cagcaactca atcaatatgc cgaacgctgg      1320
     ttacaacaac aactaggtat tgtgacttta ggaggatggt atgttggccg tccggttatg      1380
     atgacttata acgattacca gcttggcatt tcaaatggtg acattggttt atgttttgaa      1440
     catagaaccc agccgcaaca gtttgaagtg tatttcccaa gtttaaataa gtgggttgct      1500
     gcaaatcggc tacctaaaag tattcaaagt gcatttgcct taacaattca caaatcacaa      1560
     ggttctgaat ttacccatac agctgttgtt cttgatcagg ctgccaagaa tttgttaagc      1620
     caggagttga tctacactgc gattacacga gccaaaaaag tagtgagttt attggtcgat      1680
     ccagaggcgt tactccaatc ctttacagtt cgcacgacaa gaaaaagcgg tttagttgaa      1740
     aaagttaatc ggttagttcg ttaa                                             1764
//

If you have problems or comments...

PBIL Back to PBIL home page