(data stored in ACNUC29543 zone)

EMBL: CP000521.PE342

CP000521.PE342       Location/Qualifiers
FT   CDS_pept        394780..395049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0360"
FT                   /product="30S ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10820"
FT                   /db_xref="GOA:A3M1M6"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1M6"
FT                   /protein_id="ABO10820.1"
FT                   /translation="MALTNADRAEIIAKFARAENDTGSPEVQVALLTAQINDLQGHFKA
FT                   HKHDHHSRRGLIRMVNQRRKLLDYLNGKDHERYTALIGALGLRR"
     atggctttaa ctaatgcaga ccgcgcagag atcattgcta aatttgctcg cgctgaaaac        60
     gacactggtt caccagaagt acaagtagct ttattgactg ctcaaatcaa tgatttacaa       120
     ggtcacttca aagctcacaa acacgaccac cacagccgtc gcggtttgat ccgtatggtt       180
     aaccaacgtc gtaaattgct tgactactta aatggtaaag accacgagcg ttacactgct       240
     ttgatcggtg ctttaggtct acgtcgttaa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page