(data stored in ACNUC29543 zone)

EMBL: CP000521.PE346

CP000521.PE346       Location/Qualifiers
FT   CDS_pept        complement(399278..400234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0364"
FT                   /product="curved DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10824"
FT                   /protein_id="ABO10824.2"
FT                   /translation="MAKNYYEELGVKREASADEIKKAYRKLARKYHPDISKEKDAEEKM
FT                   QAINVAYDTLSNPEKKAEYDQMLDHPQGFNGFGQGAAQGGFDGARFYRQGFTGGEQADF
FT                   SGFEDLFGRFGTGFGGGQQQYQRQQRSYRGEDQHASIEVDLDIAYHGSTQHITLQIPTI
FT                   NAYGEPEVQRKTLQVKIPKGMKEGQQIRLSGQGQSGINGGANGDLYIEIQYKDTDRVHV
FT                   EGSDVYLTVDVAPWEAALGQGIEVKTPAGPLHVNLPKNAKQGQQLRLKDKGIPNKTPGH
FT                   LYLILNIVFPPAHSEKEKEAYQQLAEAFASFEPRSSH"
     atggccaaaa attattatga agaattaggg gttaaacgag aagcctcagc tgatgaaatt        60
     aaaaaagcgt atcggaaatt agctcgtaaa tatcatcccg acatcagcaa agaaaaagat       120
     gcagaagaaa agatgcaggc aattaatgtt gcctacgata ccctaagcaa ccctgagaaa       180
     aaagctgaat acgaccaaat gttagaccat ccacaaggtt ttaatggttt tggtcaaggg       240
     gcagctcaag gtggtttcga tggtgccaga ttttatcgtc aaggttttac aggcggtgag       300
     caagcagact ttagtggctt tgaagactta tttggacgct ttggtacagg ctttggcggt       360
     ggacaacagc aatatcaaag acaacaacgt agttatcgag gtgaagacca gcatgccagc       420
     atagaggtcg atcttgatat tgcttaccat ggatcaacac aacatatcac actgcaaatt       480
     ccaaccatca atgcttatgg tgaaccagag gtacaacgaa aaaccttaca ggtaaaaata       540
     cctaaaggca tgaaagaagg tcagcaaatt cgcctaagtg gacaaggaca aagtggtatt       600
     aatggtggtg ccaatggcga tctttatatc gagattcaat ataaagatac agatcgtgtg       660
     catgtcgaag gcagtgatgt atatttgact gtagatgtag caccatggga agccgcatta       720
     gggcaaggca ttgaagtaaa aacacctgcg ggacctttac acgtcaattt acctaaaaat       780
     gcaaaacaag gacaacagct acgtttaaaa gacaaaggga taccaaataa aacgccaggc       840
     catctttatt taattttaaa tattgtattc ccaccggcgc attctgaaaa agaaaaagaa       900
     gcctatcagc aattggcaga agcctttgct tcattcgaac ctcgttcatc tcattag          957
//

If you have problems or comments...

PBIL Back to PBIL home page