(data stored in ACNUC29543 zone)

EMBL: CP000521.PE347

CP000521.PE347       Location/Qualifiers
FT   CDS_pept        complement(400385..400996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0365"
FT                   /product="putative amino-acid efflux transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10825"
FT                   /protein_id="ABO10825.2"
FT                   /translation="MNYFDYFLFIFSVIIMIATPGPVMILVASVGLKGGYKKALETIFG
FT                   TNLASLVLIFISVLVLKGVLGINENYLNIIRVLGCLYIGYLGFSILKEVIQAPHPEAIQ
FT                   TVSAQNGGFKKGFLVGISNPKDIIFFSAFFPQFVSISPHLDLSLTILTLTWIVLDFLTL
FT                   SLVYIFFRRLSNSHLYPKILGLCGLLLLVIAVYGLYQTFT"
     atgaattatt ttgattattt tctctttatt tttagtgtca ttattatgat tgcgacccct        60
     ggccctgtca tgattttagt ggcaagtgtc ggacttaaag gtggttataa aaaagcactg       120
     gaaaccattt ttggtacaaa ccttgcctct ctcgttttaa tttttatttc agtactcgta       180
     cttaaaggcg tattgggtat taatgaaaac tatttaaata ttattcgtgt tttaggctgc       240
     ctatatattg gttatttggg ttttagtatt ctcaaagaag tcattcaagc tcctcatcct       300
     gaagcaattc aaaccgtttc tgctcaaaat ggtggtttta aaaaaggctt tttagtgggt       360
     atttcaaacc ctaaagatat tattttcttt tcagctttct ttccgcaatt tgtttctatt       420
     tcacctcatc tagatttaag tttaactatt cttacgctga catggatagt tttagacttt       480
     ttaacgctat ctttagtcta tatatttttc cgccgcctct cgaacagcca tttatacccg       540
     aagatcctcg gtttatgcgg tctattactg ttagttattg ccgtttacgg tttatatcag       600
     acattcactt aa                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page