(data stored in ACNUC29543 zone)

EMBL: CP000521.PE348

CP000521.PE348       Location/Qualifiers
FT   CDS_pept        complement(401134..402009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0366"
FT                   /product="heat shock protein Hsp33"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10826"
FT                   /protein_id="ABO10826.2"
FT                   /translation="MSDLRQRFYIEDFPVRGEVVHLEEALKTILAQRDYMPAVQILLGE
FT                   MLSATALLASTLKIKGRISLQIQANGSFKWAMAECNHLGEVRALADYETDPRFGEATDS
FT                   STVLAALVNPVLFINIEPEHGERYQGIVPLDQANLAGCLMQYYDLSAQIPTRIVLASTA
FT                   QRSGGLLIQLLPRHDEEEQKLVDEDLWPRLTMLTETLKSEELTELSANEILYRLYNEEE
FT                   VRLPEVEHLKFGCTCSKERCAKALIQIGVDAVHETLEAQNPIQMDCQFCNTRYEFTAEE
FT                   ALGLFGEHLS"
     atgtctgatt tacgccaacg cttttatata gaggactttc ctgttcgcgg tgaagtggtt        60
     catctagaag aagcattaaa aactatttta gctcaacgcg actacatgcc tgcggttcaa       120
     attctattag gcgagatgtt gagcgctaca gcattacttg cgagtacttt aaaaatcaaa       180
     ggtcgtatca gcttgcaaat ccaggctaac ggctctttca aatgggctat ggcagaatgt       240
     aaccatttag gtgaagttcg tgctttagca gactacgaaa cagatccacg ttttggtgaa       300
     gcaacagata gcagcactgt tttagcggct ttggttaacc ctgttttatt tattaatatc       360
     gaacctgagc atggtgagcg ttatcaaggg attgtacctc ttgatcaagc aaatttagca       420
     ggctgtttaa tgcagtacta tgacttgtct gcacaaattc caacccgaat tgtactggca       480
     agcaccgcac agcgctcagg tggtttgctc attcagttat tacctcgtca tgatgaggaa       540
     gagcaaaaac tggttgatga agatttatgg ccacgtttaa ccatgctaac tgaaacgctt       600
     aagtcagaag aactgacaga gctttcagca aatgagattt tgtatcgtct ttataacgaa       660
     gaagaagtac gtttaccaga agttgaacac ttaaaatttg gttgtacttg ttctaaagaa       720
     cgctgtgcca aagccctcat tcaaattggt gttgatgctg ttcatgaaac attggaagca       780
     caaaacccga ttcaaatgga ttgccagttc tgtaacaccc gttatgagtt cactgctgaa       840
     gaggcactgg gtctgtttgg tgaacatttg agttaa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page