(data stored in ACNUC29543 zone)

EMBL: CP000521.PE349

CP000521.PE349       Location/Qualifiers
FT   CDS_pept        complement(402175..404016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0367"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein (K(+)/H(+) antiporter)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10827"
FT                   /protein_id="ABO10827.2"
FT                   /translation="MSFLLQATIFLGASLILVPLGKRLGIATVLGYLFTGILLGPSVLN
FT                   IAHDPEAIMELAEFGVILLMFLIGLELRPQRLWEMRDSIFVMGSLQVVITGIILMLTVL
FT                   LLFQQHLAASFVIGFALALSSTAFVLQLLTEKQQLNTTYGQQSFSILLFQDIAAIPLLA
FT                   VIPLLAGTESTHHGIAYFAAIIATFTGLFLFSRYVMRPFFRFVAKSGATELITAVGLFI
FT                   ILAVVLLMDTLGISTTLGAFLTGVLLADSEFRHELEASIAPFKGLLLGLFFMTVGMTTQ
FT                   LSLLIEMPWLIIGGAIGLLVIKTLVLTAIARYKKYSWNNSLLLGTCLAQGGEFAFVILS
FT                   LAKSEKILTDALLEPVTLIVTLSMVLTPVIYWIMACKIIPLFHKELPPEYDEIPQQDNP
FT                   IIIAGFGRFGQIIARIARLQHLGFTAIDNNLHQVDFVRRYGGKLYYGDVTQPDLLRSAG
FT                   IEKAKVFILAIDDVEDSMNVARHLRLNYPNLKLLARARDRHHVHLLRDLGVEHIWRETY
FT                   LSSLGMAYRALRELGISDEQAYNNIEIFRDYDEKLLIQQQSIYTDEQKVFETHRNALAE
FT                   LEHLFESDAQQATSKHDVNLKRHLQPNRIDITRDHEE"
     atgtcattcc tactgcaagc aactattttt cttggagcat ctctgatttt agtccctttg        60
     ggcaaacgcc tagggattgc aacagtttta ggttatttat ttacgggcat acttcttggc       120
     ccgagtgtgt taaatattgc ccatgaccct gaggccatta tggagttggc tgaatttggg       180
     gtcattttac ttatgttcct gattggtcta gaactccgcc cgcaacgttt gtgggaaatg       240
     cgtgactcca tattcgtgat gggaagttta caagtcgtga ttacgggcat aattctcatg       300
     ctcaccgtat tgctgctatt tcaacaacac ctcgctgcca gctttgtgat tggttttgcg       360
     cttgcactgt cttctacggc ctttgtatta caacttctga ctgagaaaca acaactcaat       420
     accacctatg gtcagcaatc tttttcaatc ttgcttttcc aagacattgc agcaattcca       480
     ttacttgcgg tgattcctct tctggcagga accgaatcta cccatcatgg tattgcttat       540
     tttgcagcca tcatcgcgac gtttactggt ttgttcctat ttagccgtta tgtcatgcgc       600
     ccatttttcc gttttgtcgc caagagtggt gcgactgaac tgattacggc tgtagggtta       660
     tttattattc ttgccgttgt gttactgatg gacactttag gtattagcac aacattaggt       720
     gcttttctta ccggagtcct tttagccgac tcagaattcc gtcatgagct tgaagcgagt       780
     attgccccgt ttaaagggct cttacttggc ttattcttta tgaccgtagg tatgacgaca       840
     caattgtcgt tactgattga aatgccttgg ctcattattg gtggagcaat cggcctactc       900
     gtcatcaaaa ccctcgtttt aactgccatt gcccgctata aaaagtacag ttggaacaat       960
     agcttgttac tcggaacttg cttggctcaa ggcggtgaat tcgcttttgt aattttgagc      1020
     ctagcaaaaa gtgaaaagat tttaacggat gccttattag agcctgtcac gttgattgtg      1080
     accttatcaa tggtccttac cccagtgatt tactggatca tggcctgtaa gatcattccc      1140
     ctttttcata aagaattgcc acctgaatat gatgagattc ctcagcaaga taatccaatt      1200
     atcattgccg gttttgggcg ctttggacaa attattgcgc gtattgcccg cttacagcac      1260
     ttaggattta ctgctatcga taacaatctt catcaagtgg actttgttcg acgttacggc      1320
     ggtaagctct attatggtga tgtcacccag cctgacttac tccgctcagc agggattgaa      1380
     aaagcgaaag tatttatttt ggcaattgat gatgtcgaag attctatgaa tgtcgcacgt      1440
     catcttagat tgaactatcc aaacctaaaa ttactggctc gtgctcgtga ccgccaccat      1500
     gtgcacctgt taagagactt aggtgttgaa catatttggc gtgaaaccta tttatcatca      1560
     ttaggtatgg cttatcgtgc tttacgcgaa ctcggtattt ccgatgaaca agcttataac      1620
     aatatcgaaa tctttcggga ttatgatgag aaattactca tacagcagca aagcatttat      1680
     accgatgaac aaaaggtttt tgaaacccat cgtaatgctc tggcagaact tgaacaccta      1740
     tttgaaagcg atgctcaaca agccacatcg aagcacgacg ttaacttaaa gcgtcattta      1800
     caaccaaatc gtatcgacat tacacgagat cacgaagaat aa                         1842
//

If you have problems or comments...

PBIL Back to PBIL home page