(data stored in ACNUC29543 zone)

EMBL: CP000521.PE350

CP000521.PE350       Location/Qualifiers
FT   CDS_pept        complement(404093..406321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0368"
FT                   /product="ATP-dependent primosomal protein N'"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10828"
FT                   /protein_id="ABO10828.2"
FT                   /translation="MTITPKPDSVVYRVRVAVPVHLYDTFDYTLTKAQYERAQVGSRVA
FT                   ISFGRQNLIGIITEKVDPQETFTGHFQLKAISELLDDEPILDEQVLNLLTWSAQYYQFP
FT                   IGEVMQTALPALLRQGKPMDVLFHLWKIIPCDNAEALLKRSIKQQDAYQILKLHPAGTT
FT                   ENILNLSGVETATLKALQKKGLVDCTLEPHDFSPSSVQLAQMPLTLNEDQKKATQHVLN
FT                   AQHQYQAFLLDGLTGSGKTEVYLHIMHEVLKQGKQVLVLVPEIGLTPQTISRFKSRFNC
FT                   DIALLHSGLNDSKRLQAWQQAQTGKASIILGTRSAIYTPLPRLGLIILDEEHDLSYKQQ
FT                   EGFRYHARDVALYRGHLQGCPVLLGSATPSIDSYHLVETGKLTALQLNQRAGHALLPKM
FT                   HLIDLKIVKKQHGISQPLIEQIKNTLARKEQVLIFLNRRGYAPVLVCESCGWQANCPHC
FT                   DAHFTLHTQPYSYLHCHHCGTVHRLPDHCPECQQKSLKTLGAGTAKVEEHLQELFPDHD
FT                   VIRVDRDSTSRVGSWQKIYDRIQQNKPSILLGTQMLAKGHHFPHVTLVAILDIDAGLLS
FT                   VDIRAPERTAQLIVQVAGRAGRGEHKGHVYLQTLRPDHPLLTTLIEKDYRAVAKQTLAE
FT                   RKVALLPPYRYTVLIRAESKDRDYTLHFLNEAAEQLRQIAGDIVDIWGPIPAPMERKAG
FT                   RYRAHMVILSADRARLHFYLRQWWAQLVHAPRQHQLRLSIDVDPQEFS"
     atgaccataa cgccaaagcc tgattcagtt gtttatcgtg tgcgtgttgc cgtacctgtg        60
     catctgtacg acacttttga ctatacactc accaaagcac aatatgaacg ggctcaagta       120
     ggttcacgcg tcgcaatttc atttggacgg caaaacctga ttggtatcat tactgaaaaa       180
     gttgacccac aagaaacatt tacaggtcac tttcagctta aggccatttc tgaactttta       240
     gatgatgagc ctattttaga tgaacaagtt ttaaatttat tgacatggtc agcacaatat       300
     taccaatttc cgattggcga ggtgatgcag actgctttac ctgcgttatt gcgtcagggc       360
     aaacccatgg atgttttatt tcatctatgg aaaatcattc catgtgacaa tgccgaagct       420
     ttattaaaac gctcaatcaa acagcaagat gcttatcaaa ttttaaaatt acatcctgcc       480
     ggaaccactg aaaatattct caatttaagt ggtgtagaaa ctgcaacact taaagcacta       540
     caaaagaaag gtctcgtaga ctgtacgctt gagcctcatg actttagtcc atcctctgtg       600
     caattggcgc aaatgccact cacgctcaat gaagaccaaa agaaggccac tcagcacgtc       660
     cttaatgcac agcatcaata tcaagccttt ttattagatg gtttaaccgg aagtggtaaa       720
     actgaagttt acctgcacat catgcacgaa gtgctaaagc aaggtaagca agtactggtg       780
     ttagttcccg aaattggttt aacccctcaa accatttcgc gctttaagtc tcgttttaac       840
     tgcgacattg ctttattaca ttcggggtta aatgactcta aacgcctaca agcctggcaa       900
     caagcacaga ctggaaaggc ctctattatt ttaggaacac gttcagccat ttataccccg       960
     ctgccacgtt taggccttat cattttagat gaagaacacg acctgtctta taaacaacaa      1020
     gaaggtttcc gttaccatgc gcgtgatgtc gcgctttatc gaggacattt acaaggctgt      1080
     cctgttcttt taggttcggc aactccaagc attgacagtt atcacttagt cgaaactggc      1140
     aagttaactg cacttcagct gaaccagcgt gcaggccatg cgcttttacc aaaaatgcat      1200
     ttgattgatc ttaaaattgt caaaaaacag catggtatta gtcagccttt aatcgaacag      1260
     attaaaaata ccctagcaag aaaagaacag gttttaattt ttttaaaccg acgtggttat      1320
     gcacctgttc tggtctgtga aagttgtggt tggcaagcga attgtccgca ttgtgatgcg      1380
     cattttacgt tacacactca gccttattct tacttacatt gccaccactg tggcacagtt      1440
     catcgcttgc cagaccactg ccctgagtgt cagcaaaaga gcctcaaaac tttaggtgct      1500
     ggcacagcca aggttgaaga gcatttacaa gaattatttc cagatcatga tgtgattcgg      1560
     gtcgatcgtg acagcaccag ccgagtcggt agctggcaaa aaatttatga tcgcattcag      1620
     caaaataaac cttcgatttt gctcggtacg caaatgttgg caaaaggtca ccattttccg      1680
     catgtgacct tggttgctat tttagacatc gatgcaggtt tattgagtgt cgatattcga      1740
     gcgccagagc gtactgctca attgattgta caagtggctg gtcgtgcagg ccgcggagaa      1800
     cataagggtc atgtttattt acagacttta aggccagatc atcctttact caccacactc      1860
     atcgaaaaag attatcgggc agtcgcgaaa caaacattgg ctgagcgtaa agttgcatta      1920
     ctgccgcctt atcgctatac cgtacttata cgcgctgaat cgaaagatcg tgactatacc      1980
     ttgcattttt taaatgaagc tgccgagcaa cttcgccaaa ttgcaggtga cattgttgat      2040
     atctgggggc caattccagc gccaatggaa cgtaaagcgg gacgttaccg cgcacatatg      2100
     gtgattttgt ctgctgaccg cgctcgtctg catttttact taagacaatg gtgggctcag      2160
     ttggtccatg cgccaagaca gcatcaactt agactctcaa ttgatgttga cccgcaagaa      2220
     tttagttag                                                              2229
//

If you have problems or comments...

PBIL Back to PBIL home page