(data stored in ACNUC29543 zone)

EMBL: CP000521.PE351

CP000521.PE351       Location/Qualifiers
FT   CDS_pept        406470..407675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0369"
FT                   /product="general secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10829"
FT                   /protein_id="ABO10829.2"
FT                   /translation="MPAYQFTAIDASGKQQKGVLEGDSARQIRQQLRDKAWTPISVDPV
FT                   EQKDKHQSHGLFQKKFSAYDLALMTRQLSVLVAAAIPLEEALRAVSRQSEKAHVQNLLL
FT                   SVRSKVLEGHSLAQGMQQSGRFPDLYIATVAAGERSGHLDLILDQLSDYTENRFAMQKK
FT                   VQGAMIYPIILMLMSFGIVMGLMTYVVPEIVKTFDQSKDALPWITVALMKASDFIRHAW
FT                   VFIILFAIVGVVAFVRFLKTTAGHYAFDRLTLKLPLFGKLSRGINAARFASTLSILTRS
FT                   GVPLVDALKIGAAVTNNWVIRDSISQAAERVTEGGNLGTQLERSGYFPPMMVQMIRSGE
FT                   ASGELDRMLERASTMQDREVTTFISTLLALLEPLMLVLMASIVLVIVIAVMLPIVNMNN
FT                   MI"
     atgcctgcat atcaatttac tgctattgat gcttcaggga agcaacaaaa gggggtgctt        60
     gaaggagact cggcacgtca gattcgccaa caattacgcg ataaagcatg gactccgatt       120
     agcgttgacc cggttgaaca aaaagataag catcaaagcc acggattatt ccaaaaaaag       180
     tttagtgctt atgatttagc actgatgacc agacagcttt cggttttggt tgctgctgca       240
     attcctttag aagaagctct ccgcgccgtg agcagacaaa gtgaaaaagc gcatgtacaa       300
     aatcttttac tctcagttcg ttcgaaagta ttggaagggc attcactcgc acaaggtatg       360
     caacagtcag ggcgttttcc tgacctttat attgctactg ttgccgcagg tgagcgttcg       420
     gggcatttag atctcatttt agatcagcta tcagactaca ccgagaaccg ttttgccatg       480
     caaaagaaag ttcaaggtgc catgatttac ccaatcattt taatgctgat gtctttcggt       540
     attgtgatgg gattaatgac ttatgtggtc ccagagattg taaaaacctt cgatcaaagc       600
     aaagatgcct taccatggat tacagttgct ttaatgaaag cgagtgattt tatccgtcat       660
     gcatgggtat ttattattct ttttgcaatt gtaggggtag tagcttttgt ccgtttttta       720
     aaaactactg cgggacatta tgcttttgat cgattaacac tcaaattgcc attattcggt       780
     aaactatccc gtggtattaa tgctgcgcgc tttgccagta ctttatctat tttgactcgt       840
     tcaggcgtgc cattggtaga tgccttaaag attggtgctg ctgtgaccaa taactgggtc       900
     atccgtgatt caatttccca agcggctgag cgtgttaccg aaggtggtaa cctcggtacg       960
     caactggagc gcagtggtta tttcccacca atgatggtac aaatgattcg aagtggtgag      1020
     gcatcaggtg agcttgaccg tatgcttgaa cgtgcgtcga ccatgcaaga ccgcgaggtg      1080
     acgacattta tctcaacctt attggcatta cttgaaccgc ttatgctggt gttaatggca      1140
     agcatcgtac tggttattgt aattgcggtt atgctgccaa tcgtaaatat gaacaatatg      1200
     atttaa                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page