(data stored in ACNUC29543 zone)

EMBL: CP000521.PE353

CP000521.PE353       Location/Qualifiers
FT   CDS_pept        408547..408891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0371"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10831"
FT                   /protein_id="ABO10831.2"
FT                   /translation="MKAFLVLDELNQFHWAMLKSVLLILALLPIAEVSLKLWLSTEGSS
FT                   QIMIGFFALSIVSAWLMVSFFTALKTSVWQTKQMASKYEQLLFKAYRYVPMVFLSSLVA
FT                   YLSLQLSIAF"
     atgaaagcat ttctcgtact tgatgagctg aatcagtttc attgggcgat gcttaaatct        60
     gtcctattga ttttagcatt attacctatt gctgaagttt cattaaagct atggttgagt       120
     actgagggaa gtagccaaat catgattggt ttctttgcct taagtattgt aagcgcttgg       180
     ttaatggtga gcttctttac cgcattaaaa acgagtgtat ggcaaactaa acagatggct       240
     tctaaatacg aacaattgct ttttaaagct tatcgttatg tgccgatggt ttttttatcg       300
     agtttagttg cttatttatc tttgcaatta tcgattgctt tttaa                       345
//

If you have problems or comments...

PBIL Back to PBIL home page