(data stored in ACNUC29543 zone)

EMBL: CP000521.PE354

CP000521.PE354       Location/Qualifiers
FT   CDS_pept        409036..409374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0372"
FT                   /product="protein secretion chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10832"
FT                   /protein_id="ABO10832.2"
FT                   /translation="MEQIEWNDFLKVELRVGKIIQAEVFEKARKPAYILHVDFGEELGV
FT                   RKSSAQITKFYQPQDLIGKLVVAVVNFPKKQIGPIQSECLVTGFHNADGDVVLCIPEFE
FT                   VPLGTKLL"
     atggaacaaa tcgagtggaa tgacttttta aaagtagaac tgcgcgttgg taaaattatt        60
     caagctgagg tttttgaaaa ggcgcgtaaa cctgcctata ttttgcatgt agattttggt       120
     gaagagttgg gtgtacgtaa atcgagtgca cagattacaa aattttatca accgcaggat       180
     ttgattggta aattagttgt tgcggtagtg aatttcccta agaaacaaat tggtcctatc       240
     caatcggaat gtttggtaac agggtttcat aatgcagatg gggatgtagt actttgtatc       300
     ccagagtttg aagtacctct gggtacaaag ctattataa                              339
//

If you have problems or comments...

PBIL Back to PBIL home page