(data stored in ACNUC29543 zone)

EMBL: CP000521.PE355

CP000521.PE355       Location/Qualifiers
FT   CDS_pept        complement(409376..410866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0373"
FT                   /product="apolipoprotein N-acyltransferase copper
FT                   homeostasis protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10833"
FT                   /protein_id="ABO10833.2"
FT                   /translation="MLIALFSGAVFSFALAPYYWWWLAILSPALLYATLHNRSAKQAFA
FT                   IGWSYGFGLWFVGAFWLYTSIHIYGDTNAFLSVCMIAVMALVMGLFTAFQTWIYRRFFP
FT                   ETPLTFAPLWIIFEWAKTWVFTGFPWLFVGYAFTERLLDGYAPLFGIYAISFVVIVLAC
FT                   ALVEVLRKRIFWVIPAALLVLGAWGASYIQFVQPKAAKPLSVSLIQGNIPQDLKWLTEY
FT                   QVRTLEIYAGLTQSEWGRDLIVWPESSIPLFQTDIEPFLDAMDAQAKKNHTAWVTGIPY
FT                   WDVAKSHQVGSPLYYNSIMASGSDSSGLYKKQRLVPFGEYIPLSGLLSWVLPAMQNDIS
FT                   MSGFTRGESDQKPLLIKGHALAAAICYEVAYPNLTRRNAEDSDFLVTVSNDAWFTGTAG
FT                   PWQHLQMVQMRAKENGRWFIRATNTGITAFIDQNGHITEQAPIDKEFVLRGDLPAMQGQ
FT                   TLYNRLGDYPILGFAILLLVLGWIYRPRKVDVSYKSRR"
     ttgctcattg ctttattttc aggtgccgtg ttcagttttg cactggcacc ttattattgg        60
     tggtggctgg caattttgtc tccagcccta ctctatgcga cattgcataa ccgctcagcc       120
     aaacaagcat ttgcaattgg ctggagttat ggttttggtt tatggtttgt aggggctttc       180
     tggctctata cgtcgatcca tatatatggc gataccaatg cttttctaag cgtatgtatg       240
     attgctgtta tggcccttgt aatgggctta tttacagcat ttcagacatg gatttatcga       300
     cgcttctttc ctgaaacacc gctgactttc gcccctctct ggattatttt tgagtgggct       360
     aaaacttggg tatttaccgg tttcccttgg ctatttgtag gttacgcttt tactgaacgt       420
     ttactcgatg gttatgcgcc gctatttggt atttatgcaa tttcctttgt agtcattgta       480
     ttagcatgtg ctttagttga agttctacgt aagcgtattt tctgggttat ccctgctgcc       540
     ctgttagttt taggtgcatg gggagcatca tatattcagt ttgtacaacc taaagcggct       600
     aaaccgctta gcgtttcgct cattcaaggt aacattccac aagatttaaa atggctaacc       660
     gaatatcaag ttagaacatt agaaatttat gctggtttga ctcaatctga atggggccgt       720
     gacctcattg tatggcctga gtcttcaatt ccactcttcc aaaccgacat tgaaccgttt       780
     ttggatgcaa tggatgcaca agctaaaaag aaccataccg cttgggtaac tggcatacct       840
     tattgggatg tagcgaaatc gcatcaagtc ggaagtccac tgtattacaa cagtattatg       900
     gcctctggca gcgattcaag cggcctttat aaaaagcagc gtctcgtacc ttttggtgaa       960
     tatattccgc tgtcaggttt gctttcttgg gttttaccag ccatgcaaaa tgatattagc      1020
     atgagcggtt ttacacgtgg tgagagtgat cagaaaccac ttttaattaa agggcacgcg      1080
     cttgcggctg caatttgtta tgaagtggct tacccgaatc tgacacgtcg taatgcagaa      1140
     gatagcgact ttttggtaac tgtatctaac gatgcttggt ttaccggaac agctggccca      1200
     tggcaacatt tacaaatggt gcagatgcgt gcgaaagaaa atggtcgctg gtttattcgt      1260
     gcaactaaca caggtataac agcgtttatt gatcaaaatg gtcatatcac cgaacaagca      1320
     ccgattgata aagagtttgt cttgagaggc gatttaccag ccatgcaagg tcaaactctc      1380
     tataaccgtc taggtgatta tccaatttta ggatttgcaa tattactgct ggttttaggt      1440
     tggatttatc gtccacgtaa agtagacgtg tcttacaaat cacgtcgcta a               1491
//

If you have problems or comments...

PBIL Back to PBIL home page