(data stored in ACNUC29543 zone)

EMBL: CP000521.PE359

CP000521.PE359       Location/Qualifiers
FT   CDS_pept        412356..412736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3496"
FT                   /old_locus_tag="AS1_3496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3496"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89921"
FT                   /protein_id="ABS89921.2"
FT                   /translation="MNDYFVKQSLIICLWFFCIAGLLRIEVSWLSENITILILFILIIL
FT                   GSVILGYSNTHFAPVPKVKMSLILHTRFMGFLLILDLLFGKSVWYFDLARNFGFLGLFL
FT                   LGTFIFYKRNLNLNVAKIPPFE"
     gtgaatgatt attttgtaaa acagagttta attatatgtc tttggttttt ctgtattgca        60
     ggtttgttac gtattgaagt ttcttggtta tccgagaata ttactatctt aattctattt       120
     attttgatca ttcttggttc agttatattg ggttatagca atacacattt tgctcctgta       180
     cctaaagtta aaatgagttt gatcttacac acaaggttta tggggttttt actaattctc       240
     gatttattat ttggtaaatc agtttggtac ttcgatttag cgcgaaactt tggttttctc       300
     ggcttatttt tattaggcac atttattttc tacaaaagga atcttaattt aaacgtagca       360
     aaaatacctc cttttgaata a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page