(data stored in ACNUC29543 zone)

EMBL: CP000521.PE361

CP000521.PE361       Location/Qualifiers
FT   CDS_pept        414723..415334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10838"
FT                   /protein_id="ABO10838.2"
FT                   /translation="MVNQNNSPSDMGKIPLSDDKNLMNIAQYLKGVQQSHKRSILPLEQ
FT                   WHPKHCGKMDLTVKANGEWWHEGQLIKRQALLDLFTKVLWKEEGKFYLKTPVEQIEIEV
FT                   EDEPLLVNQVDQIEISGDEFLQLTTTNQDVILVDAEHPIFMREYAGELRPYVHVRFGIN
FT                   ALIQRQAFYHLVNYGTLVENDKGETILQLKSGNLHLQLGT"
     atggtaaatc aaaataattc cccatcggat atgggaaaaa taccgttatc tgatgataaa        60
     aacttaatga acattgcaca atacttaaaa ggtgtacagc aaagtcacaa aaggtcaatc       120
     ctacctttag agcaatggca tccaaagcat tgcggtaaaa tggatttaac ggtgaaagcc       180
     aatggagaat ggtggcacga aggtcaatta atcaagcgcc aagccctatt ggatttgttt       240
     accaaagtcc tatggaaaga agagggtaaa ttctacctga aaacccctgt agaacaaatt       300
     gaaatcgaag ttgaagatga acctttatta gtcaatcagg tagatcagat tgaaatttca       360
     ggtgatgagt ttctacaact gacgacgacc aatcaggatg tgattttagt tgatgcagaa       420
     cacccgattt ttatgcggga atatgcaggg gagttgcgtc cttatgtcca tgttcgattt       480
     ggtattaatg cgcttattca acgtcaggct ttctatcatc tcgtgaacta tggaacactg       540
     gtcgaaaatg ataaaggcga aaccattttg cagttaaaaa gtggtaattt gcacttgcaa       600
     ttaggcactt ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page