(data stored in ACNUC29543 zone)

EMBL: CP000521.PE37

CP000521.PE37        Location/Qualifiers
FT   CDS_pept        43719..44336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0037"
FT                   /product="alkali-inducible disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10532"
FT                   /protein_id="ABO10532.2"
FT                   /translation="MKKLVLGGLSAAIMAVSGSAMAADFVAGKDYTVIANPGKVEVPGK
FT                   IEVREFFWYGCPHCFKLEPHMQTWLKQIPSDVRFVRTPAAMNKVWEQGARTYYTSEALG
FT                   VRKRTHLPLFHAIQVNGQQIFDQASAAKFFTRYGVPEQKFNSTYNSFAVTAKVAESNKL
FT                   AQQYQLTGVPAVVVNGKYVVQGEDGKVTQVLNYLIEKERKAK"
     atgaaaaaat tggttttggg tggtttgagt gcagcaatta tggccgtatc gggtagtgca        60
     atggcagcag attttgttgc tggtaaagac tacaccgtaa tcgccaatcc aggcaaagtg       120
     gaagtaccgg ggaaaatcga agttcgtgag ttcttttggt atggctgtcc gcactgtttt       180
     aaacttgaac cacatatgca aacgtggtta aaacaaattc cgagtgatgt acgttttgtg       240
     cgtacgccag cagccatgaa caaagtatgg gaacaagggg cacgtactta ctatacatct       300
     gaggcattag gtgtacgtaa gcgcacgcat ttaccattat tccatgcaat tcaagtgaat       360
     ggtcagcaga tttttgacca ggcttctgcg gctaaattct ttactcgtta cggtgtgcct       420
     gaacaaaaat ttaatagcac ttacaactca tttgctgtaa ctgcaaaagt tgctgagtca       480
     aataaacttg ctcaacagta ccaattaaca ggcgttccag cagtagtcgt taatggtaaa       540
     tatgtggtgc aaggtgaaga tggtaaagtt actcaagtac ttaattactt aattgaaaaa       600
     gaacgtaagg caaaataa                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page