(data stored in ACNUC29543 zone)

EMBL: CP000521.PE370

CP000521.PE370       Location/Qualifiers
FT   CDS_pept        421322..421732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10847"
FT                   /protein_id="ABO10847.1"
FT                   /translation="MSQASPVYQGSCLCQGIRYEIKGDIGDIIQCHCQRCRKSNGTAFA
FT                   TNAPINSADFKITQGEDLIKKFAVNGVYRWFCSECGSPLISSRDAQPELYRLRIGTLDT
FT                   PLDQKPTMHIFAASKAEWECIHDDLPQYDERP"
     atgtctcaag catcgccagt ctatcaggga agttgtttat gtcagggtat tcgctatgaa        60
     attaaaggcg atatcggaga tattatccaa tgccattgtc aacgctgccg aaaatccaat       120
     ggaacagcat ttgcaacgaa tgctcctatc aatagtgcag attttaaaat tacgcaaggt       180
     gaagacctta tcaaaaaatt tgctgtgaat ggtgtgtacc gttggttttg tagcgaatgt       240
     ggttcaccgc ttattagctc gcgtgatgct cagcctgaac tgtatcgttt aagaattggg       300
     acactagata caccattaga ccaaaagccg acaatgcata tttttgctgc ttcaaaggca       360
     gagtgggaat gcattcatga cgatttaccg caatatgatg aacgtccatg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page